KEGG   Klebsiella sp. LTGPAF-6F: BJF97_27925Help
Entry
BJF97_27925       CDS       T05751                                 

Definition
(GenBank) mannitol-1-phosphate 5-dehydrogenase
  KO
K00009  mannitol-1-phosphate 5-dehydrogenase [EC:1.1.1.17]
Organism
kll  Klebsiella sp. LTGPAF-6F
Pathway
kll00051  Fructose and mannose metabolism
kll01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kll00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    BJF97_27925
Enzymes [BR:kll01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.17  mannitol-1-phosphate 5-dehydrogenase
     BJF97_27925
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mannitol_dh_C Mannitol_dh Plant_all_beta 3HCDH_N
Motif
Other DBs
NCBI-ProteinID: AOV14660
UniProt: A0A1D8K1A5
Position
5962164..5963312
Genome map
AA seq 382 aa AA seqDB search
MKALHFGAGNIGRGFIGKLLADAGIQLTFADVNQVVLDALNARHSYQVQVVGENEQVDTV
SGVDAVSSIGDEVVELIASVDLVTTAVGPVVLERIAPAIAKGLAKRKAQGITAPLNIIAC
ENMVRGTTQLKGHVFNALAEEDKAWVEANVGFVDSAVDRIVPPSASATHDPLEVTVETFS
EWIVDKTQFKGELLNIPGMELTDNLMAFVERKLFTLNTGHAITAYLGKLAGHQTIRDAIL
DEHIRAVVKGAMEESGAVLIKRYAFDAQKHAAYIQKIIGRFENPYLKDDVERVGRQPLRK
LSAGDRLIKPLLGTLEYGLPHRNLVKGIAAAMHFRSEEDPQAQELAALIAEKGPQAALAQ
ISGLDAASEVVAEAVNDYNATK
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcattacattttggcgcaggtaatatcggtcgtggctttatcggcaaactgctg
gcggacgcggggatacagctgacgtttgcggatgtaaatcaggtcgtgctcgatgccctg
aatgcccgtcatagctaccaggttcaagtggtcggcgagaatgagcaggtcgataccgtt
tccggcgttgacgccgtcagcagcatcggcgacgaagttgtagagctgattgccagcgtg
gatctggtgaccaccgccgtcggcccggtcgtgctggaacgcatcgccccggcgattgcc
aaaggcctggccaaacgtaaggcgcaggggattaccgccccgctgaatatcatcgcctgc
gagaacatggtccgcggcaccacccagctgaagggtcacgtttttaacgccctcgccgaa
gaagacaaagcctgggttgaagccaacgtcggcttcgttgattccgccgttgaccgcatc
gttccgccatctgcttccgccactcacgatccgctggaagtcaccgtggaaaccttcagc
gagtggattgtcgataagacccagttcaaaggcgaactgctaaacatcccaggtatggaa
ttaaccgataacctgatggcatttgtcgaacgtaagctattcaccttaaacaccggacat
gctataaccgcctacctcggaaaactggcgggtcatcagacgattcgcgacgcgattctt
gatgagcacattcgcgccgtggtcaaaggcgccatggaagagagcggcgcggtgctgatc
aaacgctatgcctttgatgcgcaaaagcacgccgcttacatccagaaaattatcggtcgt
tttgagaacccgtatctgaaggatgacgttgagcgcgttggccgccagccgctgcgcaaa
ctgagcgcgggcgaccgcttaattaagccgctgctcggtacgctggaatacggcctgccg
caccgcaatctggtgaaagggatcgccgctgccatgcacttccgcagcgaagaagacccg
caggcgcaggaactggcggcgctgattgccgagaaaggcccacaggccgcgctggcgcag
atttcgggtctggacgcagcaagcgaggtggtggcggaagccgttaacgactataacgcc
accaaatga

DBGET integrated database retrieval system