KEGG   Pantoea rwandensis: LH22_04530Help
Entry
LH22_04530        CDS       T03331                                 

Definition
(GenBank) phosphatidylserine decarboxylase
  KO
K01613  phosphatidylserine decarboxylase [EC:4.1.1.65]
Organism
kln  Pantoea rwandensis
Pathway
kln00564  Glycerophospholipid metabolism
kln01100  Metabolic pathways
kln01110  Biosynthesis of secondary metabolites
Module
kln_M00093  Phosphatidylethanolamine (PE) biosynthesis, PA => PS => PE
Brite
KEGG Orthology (KO) [BR:kln00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    LH22_04530
Enzymes [BR:kln01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.65  phosphatidylserine decarboxylase
     LH22_04530
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PS_Dcarbxylase
Motif
Other DBs
NCBI-ProteinID: AIR84763
Position
complement(968076..968972)
Genome map
AA seq 298 aa AA seqDB search
MFDRFKLGLNHILPKKGLTELAGWGASRRGGWLTKAVIDIFVWYYKVDMAEASKPHTGSY
RTFNDFFVRPLKEGARPIDPDATLLALPADGAVSQLGRIEGDQIFQAKGHYYSLQALLAG
NDDLAEKFVDGEFITTYLAPRDYHRVHMPCNGILREMIYVPGDLYSVNPLTARNIPNLFA
RNERVICVFDTDHGPMVQILVGATIVGSIETVWAGTITPPREGVIKRWRYPSADHDGAVV
LLKGQEMGRFKLGSTVINLFAPGRVKLAESLEAESKTRLGQPLAIALPQPGESAPLAE
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
gtgtttgatcgttttaaactcggcctgaatcatattctgcctaaaaaagggctgaccgaa
cttgccggctggggcgccagtcgtcgcggtggctggctgaccaaagcggtcatcgacatt
tttgtctggtactacaaagtggatatggccgaagccagcaaaccccataccggtagctat
cgcaccttcaatgacttcttcgtgcgtccgctaaaagagggtgcgcgcccgattgatccc
gacgcgaccttgctggcgctgccagccgatggcgcggtgagccagttaggccgcatcgaa
ggcgatcagatcttccaggcgaaaggccattactattcgttgcaggccttgctggccggt
aacgacgatctggcggaaaagttcgtcgatggcgagttcatcaccacctatctcgcaccg
cgcgattatcaccgtgtgcacatgccctgcaacggcattctgcgcgaaatgatttatgtg
ccgggcgacctttactccgtcaacccgctgacagcacgtaacatcccgaacctgtttgca
cgcaatgaacgtgtgatctgcgtcttcgataccgatcatggcccgatggtgcagatcctg
gtgggagcgactattgtgggcagcatcgaaaccgtgtgggcgggcaccattacgccacca
cgtgaaggggtgattaaacgttggcgttatccttcagccgatcatgacggcgctgttgtg
ctgttgaaaggtcaggaaatggggcgtttcaaactcggttcgacagtgattaacttgttc
gcaccgggccgcgtcaagctggcggaaagtctcgaagccgagagtaaaacccgtcttggc
caaccgctggcgattgccctgccgcagcccggcgaaagcgccccgctcgctgaataa

DBGET integrated database retrieval system