KEGG   Pantoea rwandensis: LH22_06865Help
Entry
LH22_06865        CDS       T03331                                 

Definition
(GenBank) tRNA pseudouridine synthase C
  KO
K06175  tRNA pseudouridine65 synthase [EC:5.4.99.26]
Organism
kln  Pantoea rwandensis
Brite
KEGG Orthology (KO) [BR:kln00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:kln03016]
    LH22_06865
Enzymes [BR:kln01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.26  tRNA pseudouridine65 synthase
     LH22_06865
Transfer RNA biogenesis [BR:kln03016]
 Prokaryotic Type
  tRNA modification factors
   Psudouridine synthases
    LH22_06865
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2
Motif
Other DBs
NCBI-ProteinID: AIR85200
Position
1475163..1475942
Genome map
AA seq 259 aa AA seqDB search
MLEILYQDEWLVAVNKPSGWLVHRSWLDRDEKVVVMQTVRDQIGQHVFTVHRLDRPTSGV
LLMALSSEVAHLLSQQFEQHKMQKTYHAVVRGWLDGSATLDYPLVEELDKIADKFATQER
TAQPAVTDYRSLAQVEMPVAISRYDSARYTLVEMSPHTGRKHQLRRHMVHLRHPIIGDSA
HGDLRQNRGAAEHFGMNRLMLHASALSLTHPVTREPLVIRAGLDRVWQGMLQQFGWQHQI
PEVPRVEFADEAVQDKPTE
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgctggaaatcctttatcaagatgaatggctggtcgccgtcaacaaaccgtccggctgg
ctggtgcatcgtagttggctcgatcgcgacgaaaaagtggtggtgatgcaaacggtacgc
gatcaaattggtcagcacgtatttaccgtgcatcgcctcgatcgccccacctctggcgtg
ctgttaatggcgctctccagcgaagtggcgcatttactgtcacagcagttcgagcagcat
aaaatgcagaagacctaccacgcggtggtgcgaggttggctggatggcagcgcgacactc
gactacccgttggttgaagagctggataagattgccgataagttcgcgactcaggaacgt
accgcgcagcctgccgtcactgattatcgctcactggcgcaagtagaaatgccggtggcg
atcagccgttacgacagcgcgcgttataccctggtggagatgtcgccgcataccggccgt
aaacatcagcttcgccgccatatggtgcatctgcgccacccgattattggtgatagcgcc
catggtgatttgcggcagaatcggggtgcagcagagcactttggtatgaatcgattgatg
ctgcatgccagtgcgctgagcctgacgcatccggtcacccgagaacctctggtgatccgc
gccgggctcgatcgcgtctggcaaggcatgctgcaacagtttggctggcagcatcagatc
cctgaggttcccagggttgagtttgccgacgaggcagtccaggataagccaacagaataa

DBGET integrated database retrieval system