KEGG   Pantoea rwandensis: LH22_10255Help
Entry
LH22_10255        CDS       T03331                                 

Definition
(GenBank) dehalogenase
  KO
K01560  2-haloacid dehalogenase [EC:3.8.1.2]
Organism
kln  Pantoea rwandensis
Pathway
kln00361  Chlorocyclohexane and chlorobenzene degradation
kln00625  Chloroalkane and chloroalkene degradation
kln01100  Metabolic pathways
kln01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:kln00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    LH22_10255
   00361 Chlorocyclohexane and chlorobenzene degradation
    LH22_10255
Enzymes [BR:kln01000]
 3. Hydrolases
  3.8  Acting on halide bonds
   3.8.1  In carbon-halide compounds
    3.8.1.2  (S)-2-haloacid dehalogenase
     LH22_10255
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase
Motif
Other DBs
NCBI-ProteinID: AIR85824
Position
2196991..2197659
Genome map
AA seq 222 aa AA seqDB search
MALFKPKFITFDCYGTLINFDMAGAAERCFKDRVSPQEMLAFTTDFAIYRRDEVLGAWKP
YYDVVSDALQRTCKKWGVQWSQADSDFIYTDCATWGPHPDVPAGLAKVAKEFPLVLLTNS
MNDLIPHHVPRLGAPIHMTITAEEVGAYKPQMKGFEYMLDKLNCGPEEILHVSSSLRYDL
MTCYDMGIKNKVWVNRGHDPANPAYEYTEIKDIGGLPAVVGL
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atggcactgtttaaaccgaaattcatcacctttgattgctacggcaccctgattaacttt
gacatggcgggagcggctgaacgctgctttaaggatcgtgtatccccgcaggagatgctc
gcattcaccaccgatttcgccatctatcgccgcgatgaggtgctgggagcgtggaagcct
tactacgatgtggtgagtgatgcattgcagcgcacctgcaaaaaatggggcgtgcagtgg
agccaggcagacagtgattttatctacaccgattgcgccacctggggaccgcaccccgat
gtgccggctgggctggcaaaagtggcgaaagagtttccgctggtgttgctcaccaactct
atgaacgatttgattccgcaccatgtgccgcgtctcggtgcaccgatccacatgaccatc
accgcggaagaagtgggtgcgtataagccacagatgaaaggcttcgagtacatgctggac
aagttgaattgtggtccggaagagatcctgcacgtttcgtcgagcctgcgctatgacctg
atgacctgctacgacatgggcatcaaaaacaaagtgtgggtcaatcgcggtcacgatccg
gccaacccagcgtatgaatacaccgagattaaagacatcggcggtctgcccgctgtggtt
ggactctaa

DBGET integrated database retrieval system