KEGG   Pantoea rwandensis: LH22_12780Help
Entry
LH22_12780        CDS       T03331                                 

Definition
(GenBank) hypothetical protein
  KO
K21909  D-erythrulose 1-phosphate 3-epimerase [EC:5.1.3.38]
Organism
kln  Pantoea rwandensis
Brite
KEGG Orthology (KO) [BR:kln00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    LH22_12780
Enzymes [BR:kln01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.38  D-erythrulose 1-phosphate 3-epimerase
     LH22_12780
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AP_endonuc_2
Motif
Other DBs
NCBI-ProteinID: AIR86287
Position
complement(2713286..2714224)
Genome map
AA seq 312 aa AA seqDB search
MPLTLSLNTNPLVNRFADPQDLIHTVAQQIRIRDLQLTHEFINPGWPAATINRMSRQMQK
ALRETGVRVTSGMTGPYGRLNHFGHPDVEVRRYYVDWFKTFADITAELGGEAVGSQFAIF
TQQDFNDRTRREALIEIAIDCWAEVAEHAQSAGLKYLFWEPMSIGREFGETIPACLALQQ
RLSSESFALPMWMMADIDHGDVTSADPRDYDPYAWAEAVPRYSPIIHIKQSMMDKGGHRP
FTLQYNAGGRIQPQPLLDALARGGAHDNEICLELSFKEREPTDRQVVADIAESVAFWASH
IDTGVQDLHLAS
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgcccttaacgctttcgctcaataccaacccactggtgaatcgttttgccgatccgcag
gatctgattcacaccgtggcacaacagatccgtattcgcgatctgcagttaactcatgaa
tttattaatcccggctggccagccgccaccatcaaccgcatgtcgcgccagatgcagaag
gcgctgcgagaaaccggggtgcgcgtgacatcgggtatgaccggcccctatggccgcctc
aatcattttggtcatccggacgttgaagtgcggcgctactacgttgactggttcaaaacc
ttcgcggatatcactgcggaactgggcggcgaggcggtcggatcgcagttcgccattttc
acccagcaggatttcaacgacaggacgcggcgggaggcgttgatcgagatcgcgatagac
tgctgggccgaggtggcggaacatgcccaatccgccggcttgaagtacctgttttgggaa
ccgatgagcatcggacgcgagtttggtgagaccattccggcttgcctcgcactgcagcag
cgtttgagcagtgagtcctttgccctgccgatgtggatgatggcggatatcgatcacggc
gatgtgacttcagccgacccgcgtgattacgacccttacgcgtgggcagaagcagtgccg
cgctactcgccgattattcatataaaacaaagcatgatggacaaaggcggccacagaccc
ttcacattgcagtacaatgcgggcggccgtattcagccccagccgctgctggacgcgctg
gcgcgcggcggcgcgcacgataacgaaatctgcctcgaactgagttttaaagagcgtgaa
cccactgaccgccaggtggtggcggatatcgcggaaagcgtcgcgttttgggcatcgcac
attgatacgggcgtgcaggatttgcatctggcttcctag

DBGET integrated database retrieval system