KEGG   Klebsiella sp. WCHKl090001: DA718_00255Help
Entry
DA718_00255       CDS       T05915                                 

Definition
(GenBank) mannitol-1-phosphate 5-dehydrogenase
  KO
K00009  mannitol-1-phosphate 5-dehydrogenase [EC:1.1.1.17]
Organism
klw  Klebsiella sp. WCHKl090001
Pathway
klw00051  Fructose and mannose metabolism
klw01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:klw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    DA718_00255
Enzymes [BR:klw01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.17  mannitol-1-phosphate 5-dehydrogenase
     DA718_00255
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mannitol_dh_C Mannitol_dh Plant_all_beta 3HCDH_N
Motif
Other DBs
NCBI-ProteinID: QBG05713
Position
complement(54269..55417)
Genome map
AA seq 382 aa AA seqDB search
MKALHFGAGNIGRGFIGKLLADAGIKLTFADVNQVVLDALNARHSYQVHVVGENEQVDTV
SGVDAVSSIGDEVVELIASVDLITTAVGPVVLERIAPAIAKGLAKRKAQGITAPLNIIAC
ENMVRGTTQLKGHVFNALAEEDKAWVEANVGFVDSAVDRIVPPSASATHDPLEVTVETFS
EWIVDKTQFKGELPNIPGMELTDNLMAFVERKLFTLNTGHAITAYLGKLAGHQTIRDAIL
DEKIRTVVKGAMEESGAVLIKRYAFDAQKHAAYIQKIIGRFENPYLKDDVERVGRQPLRK
LSAGDRLIKPLLGTLEYGLPHMNLVKGIAAAMHFRSEDDPQAQELAALIAEKGPQAALAQ
ISGLDAASDVVAEAVNDYNATK
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcattacattttggcgcaggtaatatcggacgtggctttatcggcaaactgctg
gcagacgcggggataaagctgacgtttgcggatgtaaatcaggttgtgcttgatgccctg
aatgcccgtcatagctatcaggttcacgtggtcggcgaaaatgagcaggttgataccgtt
tccggcgtcgacgccgtcagcagcatcggtgatgaagtcgttgagctgattgccagcgtt
gacctgatcactaccgccgtcggcccggttgtgctggagcgcattgctccggccattgct
aaaggcctggctaaacgcaaagcgcagggcattacagccccgctgaatattatcgcctgc
gaaaacatggtccgcggcacgactcagctcaaaggccacgtttttaacgctctggctgaa
gaagataaagcctgggttgaagccaacgtcggcttcgttgattccgccgttgaccgcatc
gttccgccatccgcttccgccactcacgacccgctggaagtgaccgtggaaacctttagc
gagtggattgtcgacaagacccagtttaaaggcgagctgccgaatatcccaggaatggaa
ttaaccgataatctgatggcatttgtcgagcgtaagctattcaccttaaacaccggacat
gctataaccgcctacctcggaaaactggcgggtcaccagacgattcgtgacgcgattctc
gatgagaaaatccgcacggtagttaaaggggccatggaagagagcggcgcggtactgatc
aaacgttatgcctttgatgcacagaaacacgcagcctatatccagaaaattattggtcgt
ttcgagaacccgtatctgaaagatgacgttgagcgcgttggccgccagccgctgcgcaaa
ctgagtgcgggcgatcgtttaattaagccgctgcttggtacgctggaatacggcctgccg
catatgaacctggtgaaagggatcgctgcggcgatgcacttccgcagcgaagacgacccg
caggcgcaggagctggcggcgctgattgcagaaaaaggccctcaggccgcgctggcgcag
atttcaggtctggacgcggcaagcgatgtggtggcggaagctgttaacgactataacgcc
accaaatga

DBGET integrated database retrieval system