KEGG   Klebsiella huaxiensis: DA718_04890
Entry
DA718_04890       CDS       T05915                                 

Gene name
xdhC
Definition
(GenBank) xanthine dehydrogenase iron sulfur-binding subunit XdhC
  KO
K13480  xanthine dehydrogenase iron-sulfur-binding subunit
Organism
klw  Klebsiella huaxiensis
Pathway
klw00230  Purine metabolism
klw01100  Metabolic pathways
klw01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:klw00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    DA718_04890 (xdhC)
SSDB
Motif
Pfam: Fer2_2 Fer2 Fer2_3
Other DBs
NCBI-ProteinID: QBG06571
Position
complement(1015463..1015942)
AA seq 159 aa
MNHSDRITIECRINGMGFQLSVSPGMPLSELLREQGLLSVKHGCCVGECGACTVLIDGTA
IDSCLYLAVWAAGKEIRTLEGEQQAGRLSPVQKAYAESGAVQCGFCTPGLIMATTAMLAK
PRSQPLTVLEIRRGLAGNLCRCTGYQMILQAVQACEKQE
NT seq 480 nt   +upstreamnt  +downstreamnt
atgaatcacagcgacagaatcaccatcgaatgtcgaatcaacggaatgggctttcagcta
agcgtctcaccgggtatgccgctctccgagctgctgcgcgaacaggggttattgagcgtg
aaacacggctgctgtgtcggggagtgcggcgcgtgcaccgttttgattgatggaacggcg
atagatagctgtctgtatctcgccgtctgggccgctggcaaggagattcgcacgctggag
ggagagcagcaggccgggcggctgtcaccagtgcaaaaagcctatgcagaatcgggtgcc
gttcagtgcgggttctgcacgccgggattgattatggcgaccacagccatgctcgccaag
ccgcgcagccaaccgctaaccgtcctggagattcgccgggggctggcggggaacctgtgc
cgctgcaccggctatcagatgatcctccaggccgtacaggcctgcgagaagcaggaataa

DBGET integrated database retrieval system