KEGG   Klebsiella huaxiensis: DA718_04900
Entry
DA718_04900       CDS       T05915                                 

Gene name
xdhA
Definition
(GenBank) xanthine dehydrogenase molybdenum-binding subunit XdhA
  KO
K00087  xanthine dehydrogenase molybdenum-binding subunit [EC:1.17.1.4]
Organism
klw  Klebsiella huaxiensis
Pathway
klw00230  Purine metabolism
klw01100  Metabolic pathways
klw01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:klw00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    DA718_04900 (xdhA)
Enzymes [BR:klw01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.1  With NAD+ or NADP+ as acceptor
    1.17.1.4  xanthine dehydrogenase
     DA718_04900 (xdhA)
SSDB
Motif
Pfam: Ald_Xan_dh_C2 Ald_Xan_dh_C V_ATPase_I_N
Other DBs
NCBI-ProteinID: QBG06573
Position
complement(1016822..1019125)
AA seq 767 aa
MESREATVTGESCMRVDAIAKVTGRARYTDDYVMAGMCYAKYVRSPIAHGYANSINCDDA
KNLPGVLAVFTWEDVPDIAFATAGHAWTLEAGKRDTADRYLLTRHVRHHGDAVAIVVARD
ELTAEKAALRVKVDWQPLPVITTPEAALAEGAVEIHPGGNLLKQSEMAAGNVAQAIESAD
LQIQGHYQTPVIQHCHMETVTSFAWMEEDSRISIVTSTQIPHIVRRVVGQALGIPWSCVR
VIKPYVGGGFGNKQDVLEEPMAAFLTSKLGGIPVKVSLSREECFLASRTRHAFTIDGRMG
INHDGILKGYSLDVLSNTGAYASHGHSIASAGGNKVAYLYPRSAYGYRSTTCYTNLPSAG
AMRGYGAPQVVFAVEAMMDDAATALGLDPIDVRLLNVAREGDANPLTGKIIYSAGLPECL
QKGRELFEWDKRRAEYQNQWGDIRRGVGVACFSYTSNTWPVGVEIAGVRLLMNQDGTINV
QSGATEIGQGADTVFAQMVAETVGIPVSNVHVISTQDTDVTPFDPGAFASRQSYTTAPAL
RKAALELKEKILTHAAVMLHQSAMSLTLIGGNIVLIDRPTRPLLSLKDLAMDAFYHPERG
GQLSAESSVKTTTNPPAFGCTFVDLSVDLALCKVTINRILNVHDSGHILNPQLAEGQVHG
GMGMGIGWSLFEEMIIDADSGVVRNPNLLDYKMPTMLDLPELESAFVETLEPQSAYGHKS
LGEPPIIPIAAAIRNAVKMATGVAVDTLPLTPKRLFEAFHEAGLIKG
NT seq 2304 nt   +upstreamnt  +downstreamnt
atggaatcgcgagaagcgaccgttaccggtgagtcatgtatgcgcgtggatgccattgcc
aaggtgaccgggcgggccagatacaccgatgattacgtgatggcaggcatgtgttatgcc
aaatatgttcgcagccccatagcacatggctatgccaacagcatcaattgtgacgatgcc
aaaaatttacccggcgtgctggcagtatttacctgggaagacgtgccggatattgcgttt
gccaccgcaggccacgcctggacgctggaggcgggtaaacgcgacaccgccgaccgctat
ctgctgacccgtcacgtccgtcatcacggtgacgcggtggcgattgtggtggccagagat
gagctgaccgccgagaaagcggcgctgcgggttaaggtcgactggcagcctttaccggta
ataaccaccccggaggccgcgctggctgagggtgctgtcgaaatccatcccggcggcaac
ctgctcaaacagagtgaaatggccgccgggaacgttgcgcaggcgattgaatctgcagac
ctgcagattcagggacactatcaaacgccggtcatccaacattgccatatggagaccgtc
acctcatttgcctggatggaagaggattcccgcatctccatcgtcaccagcacccaaatc
ccccacatcgtgcgccgggtcgtcggtcaggccctcggtattccgtggtcctgcgtgcgg
gtcattaagccctatgtcggcggcggatttggtaataaacaggacgtgctggaagaaccg
atggcggccttcctgaccagcaagctcggcggtattccggtgaaggtttcgctcagccgc
gaagagtgctttctcgcctcccgcacgcgacatgcttttactattgacgggcgaatgggc
atcaatcacgacggcatcttaaaaggctacagtctcgacgtgctgtctaacaccggggcg
tacgcttcgcacggtcactccatcgcctcggcgggcggcaacaaagtggcgtatctctat
ccacgcagcgcctacggataccgttcaaccacctgctataccaatctgccttcggcgggc
gcaatgcgcggatacggcgcgccgcaggttgtttttgcggtggaggcgatgatggatgat
gccgccactgcgttggggctggacccgatagatgtccgcttactcaacgtcgcccgcgaa
ggggacgccaacccgctcaccggcaaaattatctacagcgccgggctgccggagtgcctg
caaaaaggccgcgagctgtttgaatgggataaacgccgcgctgaatatcagaatcagtgg
ggagatatccgtcgcggtgtcggcgtcgcctgctttagctatacctccaacacctggccg
gtcggcgttgaaatcgccggggtccgcctgctgatgaatcaggacgggacgatcaacgtc
cagagcggtgcgacggaaattggtcagggggccgataccgtgtttgcgcagatggtggcg
gaaaccgtcggcatcccggtgagcaatgtccacgtgatttcgacccaggataccgatgtc
accccgttcgatcccggcgcgtttgcttcgcggcaaagctataccaccgcgcccgcgttg
cgcaaagcggcgctggaattgaaagaaaaaatcctcactcacgctgctgtcatgctgcat
cagtcggccatgagcctgacgctaatcggcggcaatatcgtccttatcgatcgccccacg
cgcccgctgctgtcgttgaaagacctcgccatggacgcgttttatcacccagaacgcggc
ggtcagctatcggcggaaagctcggtgaaaaccaccaccaatcccccggccttcggctgc
acgtttgttgacctgagcgtcgatctagccctgtgcaaagtcacgattaatcggatcctc
aacgtccacgactctggtcatattttgaatccacagctggcggaaggtcaggtgcatggc
ggaatggggatgggcatcggctggtcgctgtttgaagagatgattatcgatgccgacagc
ggcgtggtgcgtaaccccaacctgctggattacaaaatgccgaccatgctcgatctcccg
gaactggagagcgcgttcgttgaaacgctggagccgcaatcggcctacgggcataaatcg
ctcggcgagccgccgattattcccattgccgccgccattcgtaacgcggtcaaaatggcg
acgggcgtcgctgtcgatacgctgccgctgacgccaaaacggctattcgaggcgtttcat
gaagcgggtttgattaaaggataa

DBGET integrated database retrieval system