KEGG   Klebsiella huaxiensis: DA718_05350Help
Entry
DA718_05350       CDS       T05915                                 

Definition
(GenBank) exodeoxyribonuclease V subunit alpha
  KO
K03581  exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
klw  Klebsiella huaxiensis
Pathway
klw03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:klw00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    DA718_05350
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:klw03400]
    DA718_05350
Enzymes [BR:klw01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     DA718_05350
DNA repair and recombination proteins [BR:klw03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     DA718_05350
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_30 AAA_19 Helicase_RecD UvrD_C_2 Viral_helicase1 AAA_11 SH3_13 UvrD-helicase AAA_22 DUF2075 AAA_16 UvrD_C AAA_28 T2SSE PhoH MukB CbiA SRP54 FtsK_SpoIIIE Acetyltransf_6 AAA NTPase_1
Motif
Other DBs
NCBI-ProteinID: QBG06655
Position
1118672..1120516
Genome map
AA seq 614 aa AA seqDB search
MTMDELLLEAAEQRLLRPLDVQFALMVAQGAHPAVKLAAAILSRDAGEGHVCLPISRLED
DELLRGKAAGLREHILELIDTPDDWSKLLLGSEAVSCGERPTPIILCGERLYLNRMWRNE
LTVARFFNEANQVLDVDEARLASTLDALFPPGDDIDWQKVAAAVALTRRISVISGGPGTG
KTTTVAKLLAALIQTHASPRCRIRLAAPTGKAAARLTESLGAALRRLPLTDEQKALVPAE
ASTLHRLLGAQPGSQRLRYHAGNPLHLDVLVVDEASMIDLPMMSRLIDALPEHGRVIFLG
DRDQLASVEAGAVLGDICAWVNAGYTPERAAQLGRLTGQPVPAGESEAAGALRDSLCLLQ
KSYRFGRHSGIGNLAYAVNSGERSAVRATLRQPFDDITLHPLSTTEEYEAMLIQAQAGYG
RFLQLLRERAEPEEMIAAFGEFQLLCALRDGPYGVSGVNEQLEQMLNRKRAITLPRHSRW
YEGRPVMISRNDSALGLFNGDIGIALERGDGLRVWFPMPDGSIKSVQPSRLPEHDTAWAM
TVHKSQGSEFDHAALILPSRSVPLLTRELVYTAITRAKQQLSIYADEQVLTQAVVARTER
RSGLTEIFAGQGHL
NT seq 1845 nt NT seq  +upstreamnt  +downstreamnt
atgactatggacgaactgttgttggaggccgctgagcagcgcctgctgcgcccgctggat
gtccagtttgcgctgatggtggcgcagggtgcgcaccctgcagtgaaactggccgccgcg
attctgagccgtgatgcgggtgaagggcacgtctgcttgccgatctctcgtctcgaagat
gatgagctgctgagaggaaaagcggcgggcctgcgcgagcacatccttgagctgatagat
accccggatgactggtcaaagctgctccttggctctgaggcggtaagctgcggcgagcgg
ccgacgcccataattctctgcggcgaacggctttacctcaaccgtatgtggcgcaatgaa
ttaaccgtcgcgcgctttttcaacgaagccaatcaggtactggatgttgatgaagcccgg
ttggcttcaacgctggatgcgttgtttccgccaggggatgatattgactggcaaaaagtg
gccgcagcggttgctctgacccgacggatttcggtgatctccggcggccccggtaccgga
aaaaccaccaccgtcgccaaactgttggcggcgctgattcagacgcacgccagcccgcgc
tgtcgcatccgtctggcggcgccaaccggcaaagccgcggctcgcctgaccgaatccctt
ggcgctgcgctgcgccgtctgccgttaacggacgagcaaaaggcgttggtgccggccgaa
gccagcaccctccatcgcctgctcggcgctcagccggggagtcagcggctgcgctatcac
gctggaaacccgctgcatcttgacgtgctggtggtcgatgaagcctcaatgatcgacctg
ccgatgatgtcgcgcctgattgacgctctgcctgaacatgggcgggtcattttccttggc
gaccgcgatcagctggcctcggtagaagccggggcggtactcggtgatatttgtgcctgg
gtaaatgcgggatatacccccgaacgcgcggcccagttggggcgattaacgggtcagccg
gtgcctgcgggcgagagcgaagcggcgggggcgctgcgtgacagcctgtgcctgctgcaa
aaaagctaccgttttggtcgccattccggcattggaaatctggcttatgcggtgaacagt
ggcgaacgtagcgcagtacgcgcgacgctgcgccaaccattcgacgacatcactctgcat
ccgctgagtaccaccgaagagtacgaggcgatgctcatccaggcgcaggcaggctatggt
cgtttcctgcagttgctgcgcgaaagagccgaacccgaagagatgattgccgcattcggt
gagttccagttgctgtgcgcgctgcgcgatggtccctacggcgttagcggcgtgaatgaa
cagctggagcagatgctaaatcgcaagcgggcgattaccctgccgcgccattcacgctgg
tatgaagggcgtccggtgatgatctcccgcaacgatagcgcgctggggctgtttaatggc
gatatcggcattgcgctggaaagaggtgacggcctgcgcgtctggttcccgatgcccgat
ggcagcatcaagtcggtacaaccgagccgcttgccggagcacgataccgcctgggcgatg
acggtgcacaaatcgcaagggtcggagttcgatcacgcggcgctgatcctgccttcccgc
agcgtgccgctgttgacacgtgaactggtttacaccgccattactcgcgccaaacagcag
ctgtcgatttatgccgatgagcaagtgctgactcaggcggttgtcgcacgtaccgaacgc
cgcagcgggctgacggagatctttgcggggcagggacatctctga

DBGET integrated database retrieval system