KEGG   Klebsiella huaxiensis: DA718_13860Help
Entry
DA718_13860       CDS       T05915                                 

Definition
(GenBank) succinate-semialdehyde dehydrogenase
  KO
K08324  succinate-semialdehyde dehydrogenase [EC:1.2.1.16 1.2.1.24]
Organism
klw  Klebsiella huaxiensis
Pathway
klw00250  Alanine, aspartate and glutamate metabolism
klw00650  Butanoate metabolism
klw00760  Nicotinate and nicotinamide metabolism
klw01100  Metabolic pathways
klw01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:klw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    DA718_13860
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    DA718_13860
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    DA718_13860
Enzymes [BR:klw01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.16  succinate-semialdehyde dehydrogenase [NAD(P)+]
     DA718_13860
    1.2.1.24  succinate-semialdehyde dehydrogenase (NAD+)
     DA718_13860
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: QBG08196
Position
2874693..2876078
Genome map
AA seq 461 aa AA seqDB search
MNLSATHAVSVNPTTGEMVSSLPWATEQQVDSAIALADQGYCQWRNVSVANRAAVLRNVG
SAMRVRAEELAQMISLEMGKPIAQARGEVAKSANLCDWYAEHGPAMLNTEATLVEDNKAV
IEYRPMGAILAIMPWNFPVWQVLRGAVPILLAGNSYLLKHAPNVMGSAAIIGEIFAQAGV
PAGVFGWVNATNDGVSQIINDPRIAAVTVTGSVRAGKAIGAQAGAALKKCVLELGGSDPF
IVLNDADLDEAVKAAVIGRYQNTGQVCAAAKRFIVEAGIVDAFTQKFVAAVAALKMGDPR
DEQNYVGPMARFDLRDELHEQVLATLKEGATLLLGAEKIEGAGNYYAPTVMGNVTSGMTG
FRQELFGPVATITEARDADHALALANDSEFGLSATVYTTSEEQAQRFASELECGGVFING
YCASDARVAFGGVKKSGFGRELSHFGLHEFCNVQTVWKDRR
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atgaatttatctgcaactcatgcggtttccgtgaatccgacgacaggtgaaatggtgtcc
tctctgccctgggctaccgaacagcaagttgattcagcgattgcccttgcggaccagggt
tattgccagtggcgcaacgtcagcgtggcgaaccgcgcggcggtgctgcgtaacgtcggc
agcgcaatgcgtgtccgcgctgaagagctggcgcaaatgattagccttgagatgggcaag
ccgattgctcaggcgcgcggcgaagtcgctaaatcagccaatctttgcgactggtatgcc
gagcatggtccggcgatgctgaataccgaagcgactctcgttgaagacaataaagcggtg
attgagtaccgcccgatgggcgcgatcctcgcaattatgccgtggaacttcccggtgtgg
caggtgctgcgcggtgcggtaccgattctgctggcgggtaacagctatctgctcaagcac
gcgccgaacgtgatgggcagcgcggcgataatcggtgagatcttcgcacaagcgggcgtc
ccggcaggtgtgtttggttgggttaatgctaccaacgacggcgtttcgcagattatcaac
gatccgcgtattgccgccgtgactgtcaccggcagcgtgcgggccgggaaggctataggc
gcgcaggccggcgcggcgttgaaaaaatgcgtgctggagctgggtggctccgatccgttt
atcgtgctgaacgacgccgacctcgacgaggcggtaaaggccgcggtgattggtcgttat
cagaataccgggcaggtctgcgctgccgcaaaacgctttatcgttgaagcggggattgtt
gacgcttttacgcagaaatttgtcgccgccgtcgccgcgctgaaaatgggcgatccgcgc
gatgagcagaactatgtcgggccaatggcgcgcttcgacctgcgcgatgagctacatgag
caggtgcttgcaaccttaaaagaaggtgcaaccctgctgctgggcgcggaaaaaatcgaa
ggcgcgggcaactactatgcgccgacggtgatgggaaacgtcacctccgggatgaccggt
tttcgccaggagctgtttggcccggtggcgaccatcaccgaagcacgagacgccgaccat
gcgctggcgctggcaaatgatagcgagtttggtctctctgcgacggtttataccaccagt
gaggagcaggctcagcgtttcgccagcgagctggagtgcggcggagtgtttatcaacggc
tactgcgccagcgatgctcgcgtagcgttcggcggggtgaagaaaagcggatttggtcgt
gagctatcccacttcggcctgcacgaattctgcaacgtgcaaaccgtctggaaagatcgt
cgttaa

DBGET integrated database retrieval system