KEGG   Klebsiella huaxiensis: DA718_20140Help
Entry
DA718_20140       CDS       T05915                                 

Definition
(GenBank) deaminated glutathione amidase
  KO
K11206  deaminated glutathione amidase [EC:3.5.1.128]
Organism
klw  Klebsiella huaxiensis
Brite
KEGG Orthology (KO) [BR:klw00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    DA718_20140
Enzymes [BR:klw01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.128  deaminated glutathione amidase
     DA718_20140
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CN_hydrolase
Motif
Other DBs
NCBI-ProteinID: QBG09324
Position
complement(4202228..4203016)
Genome map
AA seq 262 aa AA seqDB search
MLVAAGQFAVTPDWTTNAQICVVLMRQAVGRGASLLVLPEALLARDDNDADLSVKSAQLL
DGGFLQLLLAESKNSVLTTVLTLHVPSGEGRATNTLVALRQGKIIAQYQKLHLYDAFNIQ
ESRLVDAGQQIPPLIEVDGMRVGLMTCYDLRFPELALSLALSGAQLLVLPTAWVKGPLKE
HHWATLLAARALDTTCYIIAAGECGTRNIGQSRIVDPLGTTLAGAGEQPQLIFAELSADY
LQLVRERLPVLQNRRFAPPQLL
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgcttgttgctgccggacaatttgccgtaacgccggactggacgaccaatgcgcagatt
tgcgtcgtgctgatgcgtcaggctgtcggaagaggggcttcattgttggtattaccagaa
gcgctacttgctcgagatgacaacgatgcggatttatcggttaaatcagcccaacttctg
gatggaggctttttacagttactgctggcggaaagtaaaaacagcgtgctgacgacggtg
ctgactttgcacgtgccttcaggcgaggggcgggcaactaacacgctggtggctttacgt
cagggtaagattattgcgcaataccagaagctacacctgtatgatgctttcaatattcag
gaatcccggttggtcgatgccggacagcaaattccgccgcttattgaggttgatgggatg
cgcgtcgggctgatgacctgctacgatttgcgttttcctgaactggcgctgtcgctagcg
ctcagcggggcgcaactcttagtattacccactgcgtgggtgaaagggccgctgaaggaa
catcattgggcgactttgctggcggcgcgggcactggatactacctgttatattatcgcg
gcaggtgagtgcggaacccgcaatattggacagagtcgtattgttgatcctctgggaacg
acgctcgctggggctggagagcagccgcagttgatttttgctgagctttcagctgattat
cttcagctggttcgggaacgcttgccggtgttgcagaatcgtcgctttgcgccaccgcaa
ttattatga

DBGET integrated database retrieval system