KEGG   Klebsiella huaxiensis: DA718_24050Help
Entry
DA718_24050       CDS       T05915                                 

Gene name
apaG
Definition
(GenBank) Co2+/Mg2+ efflux protein ApaG
  KO
K06195  ApaG protein
Organism
klw  Klebsiella huaxiensis
Brite
KEGG Orthology (KO) [BR:klw00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    DA718_24050 (apaG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525 Pax2_C DUF4354
Motif
Other DBs
NCBI-ProteinID: QBG10023
Position
5044228..5044605
Genome map
AA seq 125 aa AA seqDB search
MINSPRVCVQVQSVYIESQSSPEEERYVFAYTVTLRNLGRTQVQLLGRYWLITNGNGRET
EVQGEGVVGEQPHIPAGGEFQYTSGAVIETPLGTMQGHYEMIDVNGAPFSIEVPVFRLAV
PTLIH
NT seq 378 nt NT seq  +upstreamnt  +downstreamnt
atgatcaattcgccccgagtttgtgtgcaggtacaaagcgtctatatcgaatcgcaatct
tctccagaagaagagcgctacgttttcgcttataccgtcaccctgcgtaatttggggcgg
actcaggttcagcttcttggtcgctactggcttatcaccaacggcaatggtcgtgagacc
gaagttcagggtgaaggggttgtcggcgagcagccgcatattccggccggcggcgaattt
caatataccagcggcgcggttattgaaacgccgctgggcaccatgcagggacactatgag
atgatcgatgtgaacggcgcgccgttctccattgaagtccctgttttccgtctcgcagta
cccactctcatccattaa

DBGET integrated database retrieval system