KEGG   Klebsiella sp. WCHKl090001: DA718_26035Help
Entry
DA718_26035       CDS       T05915                                 

Definition
(GenBank) sugar ABC transporter ATP-binding protein
  KO
K10820  galactofuranose transport system ATP-binding protein [EC:7.5.2.9]
Organism
klw  Klebsiella sp. WCHKl090001
Pathway
klw02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:klw00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    DA718_26035
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:klw02000]
    DA718_26035
Enzymes [BR:klw01000]
 7. Translocases
  7.5  Catalysing the translocation of carbohydrates and their derivatives
   7.5.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.5.2.9  ABC-type D-galactofuranose transporter
     DA718_26035
Transporters [BR:klw02000]
 ABC transporters, prokaryotic type
  Saccharide, polyol, and lipid transporters
   Galactofuranose transporter
    DA718_26035
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 AAA_29 SMC_N AAA_30 AAA_16 AAA_23 RsgA_GTPase AAA_22 ABC_ATPase MMR_HSR1 DUF2813 AAA_15 TsaE FeoB_N DUF815 DLIC
Motif
Other DBs
NCBI-ProteinID: QBG10372
UniProt: A0A4P6NX53
Position
complement(5463627..5465129)
Genome map
AA seq 500 aa AA seqDB search
MNGESHQEILRTEGLSKFFPGVKALDDVNFSLRRGEIMALLGENGAGKSTLIKALTGVYH
ADRGAIWLEGQAISPKNTAHAQQLGIGTVYQEVNLLPNMSVADNLFIGREPRRFGLLRRK
EMEKRATALMESYGFSLDVREPLNRFSVAMQQIVAICRAIDLSAKVLILDEPTASLDTQE
VEMLFTLMRQLRDSGVSLIFVTHFLDQVYAVSDRITVLRNGGFVGCRETRELPQIELVKM
MLGRELEHNALQRAGRTLLSDKPVAAFEDFGKKGTIAPFNLQVRPGEIVGLAGLLGSGRT
ETAEVIFGIKPADSGKAWIKGKPQTLRSPHQASCLGIGFCPEDRKTDGIIAAASVRENII
LALQAQRGWLRPIGRREQNEIAERFIRQLGIRTPSAEQPIEFLSGGNQQKVLLSRWLLTK
PQFLILDEPTRGIDVGAHAEIIRLIETLCADGLALLVISSELEELVGYADRVIIMRDRQQ
VAELALSELSVPAIMNAIAA
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atgaacggcgaatcacatcaggaaatccttcgtaccgaagggctaagcaaatttttcccc
ggcgtgaaagcgctggatgacgttaatttcagcctgcgccggggcgaaatcatggctctg
ttaggcgaaaacggcgcgggtaaatccactctgattaaagcgctcaccggcgtttatcac
gccgatcgcggggctatctggctggaaggtcaggcgatttcaccgaagaataccgcccat
gcccagcagttggggatcggcaccgtttaccaggaagtgaacctgctgcccaatatgtcg
gtggcggataatctgtttattggtcgcgaaccacgccgttttggtctgctgaggcgcaaa
gagatggaaaagcgtgccacggcgctgatggaatcctacggtttttccctcgacgtgcgc
gagcccctcaaccgcttttcggtcgcgatgcagcagatagttgctatctgccgggcgatc
gacctgtcagcaaaagtgttaattcttgatgaacccaccgccagcctggatacccaggag
gtggagatgctatttactctgatgcgccagctgcgcgatagcggcgtcagcctgattttt
gtcacccatttcctcgaccaggtttatgccgttagcgaccggatcaccgttttgcgtaat
ggcggcttcgtcggctgccgggaaacccgcgagctgccgcaaatcgaactggtaaaaatg
atgctcggccgcgagctggagcataacgccctgcagcgtgcgggccgcactctgctaagc
gacaaaccggttgccgccttcgaggattttggcaaaaaaggcaccatcgccccgtttaat
ctgcaggttcgccccggggaaatcgtcggcctggcggggctgctaggctcaggacgcacg
gaaaccgctgaggtcattttcggcatcaaacccgccgacagcggcaaagcgtggatcaaa
ggcaaaccgcaaaccctgcgctcgccgcatcaggcctcctgccttggaatcggcttttgc
ccggaagatcgtaaaaccgacggcattattgccgccgcctcggtgcgggaaaatatcatt
ctcgcgctccaggcacagcgcggttggctgcgcccgattggccgacgcgagcaaaatgag
attgccgagcgctttattcgccagctgggtattcgtacccccagcgccgagcagccgatc
gagttcctctccggtggtaatcagcagaaggtgctgctctcccgctggctgctgaccaaa
ccacagttcctgatcctcgatgagccgactcgcggtatcgacgtgggtgcccatgcggag
atcatccgactgattgaaaccttgtgcgccgatggtctggcgctgctggttatctcttcg
gagctggaagaactggtaggttacgccgatcgggtgattatcatgcgcgatcgtcagcag
gtggcggagctggctctgagcgagctctccgtcccggcgatcatgaacgctattgcggca
taa

DBGET integrated database retrieval system