KEGG   Klebsiella sp. WCHKl090001: DA718_28160Help
Entry
DA718_28160       CDS       T05915                                 

Gene name
oadA
Definition
(GenBank) oxaloacetate decarboxylase subunit alpha
  KO
K01571  oxaloacetate decarboxylase (Na+ extruding) subunit alpha [EC:7.2.4.2]
Organism
klw  Klebsiella sp. WCHKl090001
Pathway
klw00620  Pyruvate metabolism
klw01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:klw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    DA718_28160 (oadA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:klw02000]
    DA718_28160 (oadA)
Enzymes [BR:klw01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.4  Linked to decarboxylation
    7.2.4.2  oxaloacetate decarboxylase (Na+ extruding)
     DA718_28160 (oadA)
Transporters [BR:klw02000]
 Other transporters
  Primary active transporters [TC:3]
   DA718_28160 (oadA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMGL-like PYC_OADA Biotin_lipoyl Biotin_lipoyl_2 HlyD_3 HlyD_D23 Peptidase_M23
Motif
Other DBs
NCBI-ProteinID: QBG10733
UniProt: A0A4P6NYJ7
Position
5885499..5887265
Genome map
AA seq 588 aa AA seqDB search
MTVAITDVVLRDAHQSLFATRLRLDDMLPIAAQLDDVGYGSLECWGGATYDACIRFLGED
PWVRLRELKKAMPKTPLQMLLRGQNLLGYRHYADDVVERFVERAVKNGMDVFRVFDAMND
PRNMKAALQAVRSHGAHAQGTLSYTTSPAHTLQTWLDLTEQLLETGVDSIAIKDMSGILT
PSAAFELVSEIKKRHDVRLHLHCHATTGMAEMALLKAIEAGVDGVDTAISSMSATYGHPA
TEALVATLAGTQYDTGLDILKLESIAAYFREVRRKYHAFEGQLKGYDSRILVAQVPGGML
TNLEGQLKQQNAADRLDEVLAEIPRVREDLGFIPLVTPTSQIVGTQAVLNVLTGERYKTI
AKETAGILKGEYGHTPVPVNAALQARVLEGAAPVTCRPADLLKPELAQLEADVKRQAQEK
GIQLAENAIDDVLTVALFPQIGLKFLENRHNPAAFEPVPQAETAQPVAKAEKPAASGIYT
VEVEGKAFVVKVSDGGDISQLTAVAPASTPAAAAPAGAGTPVTAPLAGNIWKVIATEGQM
VAEGDVLLILEAMKMETEIRAAQAGTVRGIAVKSGDAVAVGDTLMQLA
NT seq 1767 nt NT seq  +upstreamnt  +downstreamnt
atgaccgttgccattaccgatgtcgtcctgcgcgacgcccaccagtcccttttcgccacc
cgcctgcgccttgacgatatgctgccgattgccgctcagctcgacgacgtgggctacggc
tccctcgaatgctggggcggcgccacctatgacgcctgcatccgctttctcggcgaagac
ccgtgggtccgcctgcgcgagctgaaaaaagccatgccgaagaccccgctgcagatgctg
ctgcgcggccagaacctgctcggctaccgccactacgccgatgacgtggtggagcgcttc
gttgaacgcgccgttaaaaacggcatggacgtgttccgcgtcttcgacgccatgaacgac
ccgcgcaatatgaaggcggctttacaagccgtgcgcagccacggtgcgcacgctcagggc
acgctctcgtacaccaccagcccggcgcacaccctgcagacctggctggacctgaccgaa
cagctgctggaaaccggcgtcgattccatcgccatcaaggatatgtccggcattctcacc
ccgtcggcggcctttgagctggtgagcgaaatcaaaaaacgccacgacgtgcgcctgcac
ctgcactgccacgccaccaccgggatggcggagatggccctgctgaaggccatcgaagcg
ggtgttgacggcgtcgacaccgccatctcttccatgagcgccacctacggccacccggcc
accgaggcgctggtcgccaccctcgccgggacacagtacgacaccgggctggatatcctg
aagctggagagcatcgccgcgtacttccgcgaggtgcgcaggaagtaccacgcctttgaa
ggccagctgaagggctacgacagccgtattctggtggcccaggtgccgggcgggatgctc
actaatctcgagggtcagctgaagcagcagaacgccgccgacaggctggatgaggtgctg
gcggaaattccccgcgtgcgcgaggacctcggttttatcccgctggtcaccccgacctcg
cagattgtcggcacccaggcggtgcttaacgtcctcaccggcgagcgctacaaaactatc
gctaaagaaacggcggggattctgaaaggcgaatacggccatactccggtaccggtgaat
gcggcattgcaggcccgcgtgctggaaggagctgccccggtgacctgccgcccggcggac
ctgctgaaaccggagctggcgcagcttgaggccgacgtgaagcgccaggcgcaggagaag
ggtattcagcttgcggaaaacgccatcgacgacgtgctgaccgtggcgctgttcccgcaa
atcggcctcaaattccttgagaaccgccacaacccggcggcgtttgagccggtgccgcag
gcggaaaccgcgcagccggtggcaaaagcagaaaaaccggccgcttccggtatttacacc
gtggaggtggaaggtaaggcctttgtggtcaaagtcagcgacggcggcgatatcagccag
ttgacggcggttgcacctgcctccacgccagccgctgccgctccggccggcgcaggcacc
ccggtcaccgcgccgctggcgggcaacatctggaaggtaattgccacagagggccagatg
gtggcggaaggcgacgtgctgctgattctggaagccatgaagatggaaaccgaaatccgc
gccgcgcaggccgggaccgtgcgcggtatcgccgtgaagtccggggacgcggtcgccgtg
ggcgacaccctgatgcagctggcgtaa

DBGET integrated database retrieval system