KEGG   Klebsiella sp. WCHKl090001: DA718_29215Help
Entry
DA718_29215       CDS       T05915                                 

Definition
(GenBank) nitrogen regulation protein NR(II)
  KO
K07708  two-component system, NtrC family, nitrogen regulation sensor histidine kinase GlnL [EC:2.7.13.3]
Organism
klw  Klebsiella sp. WCHKl090001
Pathway
klw02020  Two-component system
Brite
KEGG Orthology (KO) [BR:klw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    DA718_29215
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:klw01001]
    DA718_29215
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:klw02022]
    DA718_29215
Enzymes [BR:klw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     DA718_29215
Protein kinases [BR:klw01001]
 Histidine kinases
  NtrC family
   DA718_29215
Two-component system [BR:klw02022]
 NtrC family
  GlnL-GlnG (nitrogen regulation)
   DA718_29215
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HATPase_c HisKA PAS PAS_4 PAS_8 PAS_9 DUF1688
Motif
Other DBs
NCBI-ProteinID: QBG10920
Position
6108790..6109839
Genome map
AA seq 349 aa AA seqDB search
MATGTLPDAGQILNSLINSILLVDDDLAVHYANPAAQQLLAQSSRKLFGTPLPELLSYFS
LNIGLMQESLQAGQGFTDNEVTLVIDGRSHILSLTAQRLPEGYILLEMAPMDNQRRLSQE
QLQHAQQIAARDLVRGLAHEIKNPLGGLRGAAQLLSKALPDPSLTEYTKVIIEQADRLRN
LVDRLLGPQHPGMHVTESIHKVAERVVKLVSMELPDNVKLVRDYDPSLPELPHDPDQIEQ
VLLNIVRNALQALGPEGGEIVLRTRTAFQLTLHGVRYRLAARIDVEDNGPGIPSHLQDTL
FYPMVSGREGGTGLGLSIARSLIDQHSGKIEFTSWPGHTEFSVYLPIRK
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atggcaacaggcacactgcccgatgctgggcagatccttaactctttaatcaacagtatc
ttactggtcgatgacgacctggcggtgcattacgcgaaccctgctgcacagcagttgctg
gcgcaaagctcacgtaagctatttggtactccgctcccggagctgttgagctatttctcg
ctgaatattggtctcatgcaggagagcctgcaggcgggccagggctttaccgataacgaa
gtaacgctggtcatcgatggtcggtcgcatatcctgtctctgacggcacagcgccttcct
gagggctacattttgctggaaatggcaccgatggataatcagcgacgtctgagccaggaa
cagcttcagcacgcacagcagattgccgcgcgtgacttagtgcgcggtttggcccacgag
attaaaaacccgttgggtggcctgcgcggtgccgcacagttgctgagcaaagcgctgccc
gatccttcgttgacggaatacaccaaagtcatcattgaacaggccgatcggttaagaaat
ctggtcgaccgcctgctgggaccgcagcatcctggaatgcacgtcacagagagcattcac
aaggttgcagagcgagtggtgaagctggtgtctatggagttgccggataacgtcaaactg
gttcgtgactacgacccaagcctgccggaactcccacacgacccggatcaaattgaacaa
gtgctgctgaatatcgtacgcaatgcgctgcaagcgctggggcctgagggcggagagata
gtcctgcgtacccgtacggcgttccagctgaccctgcacggggttcgctaccgccttgca
gcacgtattgacgttgaagataacggcccgggaataccgtctcacttacaggatacgctg
ttttatccgatggtgagcgggcgcgaaggcggtactggcctcgggctatctatcgcccgc
agccttatcgatcagcactccggcaaaattgaatttaccagttggccagggcataccgaa
ttctcggtatacctgcctattcggaagtag

DBGET integrated database retrieval system