KEGG   Kushneria marisflavi: B9H00_04995Help
Entry
B9H00_04995       CDS       T04840                                 

Definition
(GenBank) pseudouridylate synthase
  KO
K06175  tRNA pseudouridine65 synthase [EC:5.4.99.26]
Organism
kma  Kushneria marisflavi
Brite
KEGG Orthology (KO) [BR:kma00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:kma03016]
    B9H00_04995
Enzymes [BR:kma01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.26  tRNA pseudouridine65 synthase
     B9H00_04995
Transfer RNA biogenesis [BR:kma03016]
 Prokaryotic type
  tRNA modification factors
   Psudouridine synthases
    B9H00_04995
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2
Motif
Other DBs
NCBI-ProteinID: ART64589
UniProt: A0A240UU78
Position
1060981..1061763
Genome map
AA seq 260 aa AA seqDB search
MTPPIPVIYRDDHLVVVHKPSGALVHRSALDRHAPLVMLQALRNQLGQHVYPVHRLDRPT
SGALLFALTPEVATALGHQFQQQQVQKRYLAIVRGIGPEQAIYDWALREEDGKRPKAEMP
AMEAETHVRRLDSVELPIAIDRYPTSRYSLMSVTPTTGRRHQIRRHLSRGGYPIIGDARH
GKGIHNRYFRDNFETGRLLLAAVTLEFHHPVLERTLRATAAVEEDMAALMHRFGWAGHCP
LSHVQWPETLDTSDKRDAAS
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgaccccacccatccccgtgatttatcgtgacgaccacctggtggttgtccacaagcct
tccggcgcactggtacaccgcagcgcgctggaccggcatgcaccgctggtcatgctgcag
gccctgcgcaaccagctgggacagcacgtctatcccgtacaccggctcgaccggccgacc
tcgggtgccctgctctttgccctgacgcccgaagtggccacggcgctggggcaccagttt
cagcagcaacaggtccagaaacgctacctggccattgtgcgcggcattggccctgaacag
gcgatctatgactgggccctgcgagaggaagacggcaaacgacccaaggccgagatgccg
gccatggaggctgaaacccatgtcagacgtctggacagcgtcgagctgccgatcgccatc
gatcgctatccgaccagtcgctactcgctgatgtccgttacgcccaccacagggcgccgc
catcagattcgccgtcatctgagccgcggcggctatcccatcattggcgacgcgcgacat
ggcaagggcatccacaaccggtatttccgcgacaatttcgagaccgggcgcctgttgctg
gcggccgtgaccctcgaattccatcatcctgtccttgagcgcacactcagggccaccgcc
gccgtcgaagaggacatggccgcgctgatgcatcgattcggctgggccggtcactgcccg
ctcagtcatgtacagtggccggaaaccctcgatacatctgataaaagagacgccgcatca
tga

DBGET integrated database retrieval system