KEGG   Kushneria marisflavi: B9H00_06905Help
Entry
B9H00_06905       CDS       T04840                                 

Definition
(GenBank) arginase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
kma  Kushneria marisflavi
Pathway
kma00220  Arginine biosynthesis
kma00330  Arginine and proline metabolism
kma01100  Metabolic pathways
kma01110  Biosynthesis of secondary metabolites
kma01130  Biosynthesis of antibiotics
kma01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:kma00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    B9H00_06905
   00330 Arginine and proline metabolism
    B9H00_06905
Enzymes [BR:kma01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     B9H00_06905
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-ProteinID: ART64632
UniProt: A0A240UUA5
Position
1502120..1503046
Genome map
AA seq 308 aa AA seqDB search
MNLILAPSNLGLRSQWNGHEPGTWRAPFALIKAGLLEALDSPKLTELPRPRYRAAPQQGT
QLLNGHEMRTFNLRLAELVEQYYRQDEFVLVIGGDCSILLGALAGARRMGQLSLLHIDGH
SDFRHPGNDNTGQTAGAAAGMDLALATGRGEALGTSWPDISGPLVEDRNVIQLGERENRD
ADFAWPDVNDTDITRIDVFEADRLGATGIIEIIDQALARQPDKGFWIHLDVDVLDQGIMP
AVDSPGTPGIDPETLLSVLKRFAPDLRCIGMTVTVFDPDLDPDGHYASRIVEMLARIPFG
SRRITPYE
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgaacctcattttggcaccctccaaccttggccttcgctcacaatggaatggtcatgag
ccaggcacatggcgagccccttttgcactgatcaaggccggtttactggaggctcttgac
tctccgaagctgaccgagcttccaaggcccagataccgtgcggccccgcaacagggcacg
caattgctcaacggtcatgaaatgcgaacattcaaccttcggcttgccgagctggtggag
cagtattaccgacaggatgagtttgtgctggtgatcgggggagactgctccatcctgctc
ggcgcgctcgcaggcgcgcgtcgaatgggtcagctctcgctgctccatatcgatggacac
agtgactttcgccatccgggaaatgacaacacggggcagacggcaggcgcggctgccggc
atggatcttgcgctggccaccggccggggcgaagcactggggacgagttggccggatatc
tccggccctctggtcgaggatcgcaacgtcattcagcttggcgagcgcgaaaatcgggat
gcggattttgcgtggccggatgtcaacgatactgacatcacgcgcatcgatgtgtttgag
gccgatcgtctgggtgccaccggcattattgagatcattgatcaggcgctcgcgcgacag
cccgataaagggttctggatacaccttgatgtcgacgttctcgaccagggcatcatgcct
gccgtggattctccgggcacccccggcatcgacccggaaaccctcctctctgttctgaaa
cgattcgctcccgatttacgctgcatcggtatgacagtgactgtcttcgatcccgacctt
gatcccgacggccattacgcttcaagaatcgtcgagatgctggctcgaattccctttggg
tcgcgccgcatcactccctacgagtga

DBGET integrated database retrieval system