KEGG   Kushneria marisflavi: B9H00_08335Help
Entry
B9H00_08335       CDS       T04840                                 

Definition
(GenBank) haloacid dehalogenase, type II
  KO
K01560  2-haloacid dehalogenase [EC:3.8.1.2]
Organism
kma  Kushneria marisflavi
Pathway
kma00361  Chlorocyclohexane and chlorobenzene degradation
kma00625  Chloroalkane and chloroalkene degradation
kma01100  Metabolic pathways
kma01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:kma00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    B9H00_08335
   00361 Chlorocyclohexane and chlorobenzene degradation
    B9H00_08335
Enzymes [BR:kma01000]
 3. Hydrolases
  3.8  Acting on halide bonds
   3.8.1  In carbon-halide compounds
    3.8.1.2  (S)-2-haloacid dehalogenase
     B9H00_08335
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase
Motif
Other DBs
NCBI-ProteinID: ART63057
UniProt: A0A240UNH3
Position
complement(1824456..1825130)
Genome map
AA seq 224 aa AA seqDB search
MSDIMRPKYITFDCYGTLTNFQMGTMTREIFADRIPESDRMDAFVTSFGAYRFDEVLGPW
KPYSEVLCTALERTCKRWGVEYRDNEGLQYFEAVPTWGPHPDVIEGLSKIADRIPLVIYS
NADDSQIMDNVKKLEVPFHKVFTADTFKVYKPRLEAFEAMIDTLGCRPDELLHVSSSFRY
DLMSAHFMGIKNKAFVARNHEGFCQGYGATEIADIRGLPALVGL
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacatcatgcgcccgaagtacatcacctttgactgctacggcacgctgaccaat
ttccagatgggcaccatgacccgggagatcttcgccgatcgcattcccgagtccgatcgc
atggacgcctttgtcacctccttcggcgcctatcgctttgacgaggttctcggtccctgg
aagccctactcggaggtgctgtgtacggcgcttgagcgcacctgcaagcgctggggtgtg
gagtatcgcgacaatgaaggcctgcagtactttgaagcggtgccgacctgggggccgcac
ccggacgtgatcgaggggctatcaaaaattgcggacaggattccgctggtgatctactcc
aacgccgatgacagccagatcatggacaacgtcaagaagctggaagtgccgtttcacaag
gtcttcacggcggataccttcaaggtctacaagccgcgtctggaagcctttgaggcgatg
attgatactctgggctgtcgtcccgatgagctgttgcatgtctcctcgagctttcgctac
gacctgatgtcggcacacttcatgggcatcaagaacaaggcgtttgtggcgcgcaaccat
gaaggcttctgtcagggctacggcgcgaccgaaattgccgatatccgtggtctgccggcg
ctggtcggtctctga

DBGET integrated database retrieval system