KEGG   Kushneria marisflavi: B9H00_10665Help
Entry
B9H00_10665       CDS       T04840                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
kma  Kushneria marisflavi
Pathway
kma00071  Fatty acid degradation
kma00072  Synthesis and degradation of ketone bodies
kma00280  Valine, leucine and isoleucine degradation
kma00310  Lysine degradation
kma00362  Benzoate degradation
kma00380  Tryptophan metabolism
kma00620  Pyruvate metabolism
kma00630  Glyoxylate and dicarboxylate metabolism
kma00640  Propanoate metabolism
kma00650  Butanoate metabolism
kma00900  Terpenoid backbone biosynthesis
kma01100  Metabolic pathways
kma01110  Biosynthesis of secondary metabolites
kma01120  Microbial metabolism in diverse environments
kma01130  Biosynthesis of antibiotics
kma01200  Carbon metabolism
kma01212  Fatty acid metabolism
kma02020  Two-component system
Brite
KEGG Orthology (KO) [BR:kma00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    B9H00_10665
   00630 Glyoxylate and dicarboxylate metabolism
    B9H00_10665
   00640 Propanoate metabolism
    B9H00_10665
   00650 Butanoate metabolism
    B9H00_10665
  09103 Lipid metabolism
   00071 Fatty acid degradation
    B9H00_10665
   00072 Synthesis and degradation of ketone bodies
    B9H00_10665
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    B9H00_10665
   00310 Lysine degradation
    B9H00_10665
   00380 Tryptophan metabolism
    B9H00_10665
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    B9H00_10665
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    B9H00_10665
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    B9H00_10665
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:kma04147]
    B9H00_10665
Enzymes [BR:kma01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     B9H00_10665
Exosome [BR:kma04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   B9H00_10665
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ART63466
UniProt: A0A240UQR0
Position
2352146..2353321
Genome map
AA seq 391 aa AA seqDB search
MREVVITGAGRTAIGAFQGGLSTVPAAELGATVIRGVLGNVDPASVDEVIMGHVLRAGAG
QNTARQAAIHAGLPETVPAMTIDRVCGSGLSAVTMAARAIRCGDADIVVAGGMENMSLAP
YVLPKARTGLRMGHAELLDSLLHDGLWDAFNDYHMGITAENLAERYGITRQAQDDLAVES
QRRACAARETGRFEAEIIPVEVSGRRGETTTLDRDEQPRESVTAESLSRLKPAFARDGTV
TAGNASTLNDGAAAVLVMSRERADALGLPVMAVIRGYGEAAVDPAFMGIGPVPATQRCLE
RARWSVSDLELIEANEAFAAQALAVQQQMGWSLDRVNVNGGAIALGHPIGASGARILVSL
IHEMGRREVRRGLATLCVGGGQGVAMAVERP
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgaggtcgtgatcacaggagccggacgcaccgccattggggccttccagggtggg
ctgtctaccgtgcctgctgccgagctgggcgctacagtcattcgtggcgtactgggaaac
gttgatccggcctcggtggatgaggtcatcatggggcacgtactgcgtgccggtgccgga
cagaatacggcccgtcaggccgccattcatgccggtctgcccgaaacggtgccggccatg
accattgatcgggtctgtggctccggactcagcgccgtgacgatggcggcacgggccatt
cgctgcggtgatgccgatatcgtggtggccggtggcatggagaacatgagcctggcgccg
tatgtgctgcccaaagcccgtacgggattgcgcatggggcatgccgagctgttggacagc
ctgctgcatgatggtctgtgggatgccttcaatgattatcacatgggcattaccgcggag
aatctggccgagcgttatggcattacccgtcaggcgcaggatgatctggccgtcgaatcc
cagcgtcgtgcctgcgccgcgcgggagaccggccgcttcgaggctgaaatcattccggtc
gaagtgtcgggccggcgtggtgagaccacgacccttgatcgggatgaacagccgcgcgag
agcgtgacggccgagtcactgtcgcgtctgaagccggcatttgcccgtgacgggacggtc
acggccggcaatgcttccacgctcaacgatggcgccgctgccgtgctggtcatgtcacgc
gagcgcgccgacgcgctggggctccccgtcatggccgtcatcagaggctacggtgaggcg
gccgtcgatccggccttcatggggattgggccggtaccggccacgcagcgctgtcttgaa
cgcgcccggtggtctgtcagcgatcttgaactgattgaggccaatgaggcctttgccgct
caggcactggccgtacaacagcaaatgggctggtcgctggatcgggtcaatgtcaacggc
ggtgccatcgcgctgggacaccccatcggcgcgtccggggcgagaattctggtcagtctg
atccacgaaatggggcgccgggaggttcgtcgtggactggccacactctgtgtgggcggt
ggtcagggagtggccatggccgtagagcggccctga

DBGET integrated database retrieval system