KEGG   Kushneria marisflavi: B9H00_16635Help
Entry
B9H00_16635       CDS       T04840                                 

Gene name
gcvT
Definition
(GenBank) glycine cleavage system protein T
  KO
K00605  aminomethyltransferase [EC:2.1.2.10]
Organism
kma  Kushneria marisflavi
Pathway
kma00260  Glycine, serine and threonine metabolism
kma00630  Glyoxylate and dicarboxylate metabolism
kma00670  One carbon pool by folate
kma01100  Metabolic pathways
kma01110  Biosynthesis of secondary metabolites
kma01130  Biosynthesis of antibiotics
kma01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:kma00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    B9H00_16635 (gcvT)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    B9H00_16635 (gcvT)
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    B9H00_16635 (gcvT)
Enzymes [BR:kma01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.10  aminomethyltransferase
     B9H00_16635 (gcvT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GCV_T GCV_T_C
Motif
Other DBs
NCBI-ProteinID: ART64487
UniProt: A0A240USK5
Position
3654589..3655704
Genome map
AA seq 371 aa AA seqDB search
MSTLHRTPLYTLWQQRGGRFVPFAGYEMPVQFEMGIKREHEHTRQKCGLFDVSHMGQMLI
HGSQPATALERVSPIDAAGIAHGRQRYGLFTSSVGGIHDDFMAVNAGEHLYLVVNAACRA
ADAALLRSGLGEGGDLEVVEDRALLALQGPMARDVMSDLCPSATELTFMQHARFEIMGHE
VWISCSGYTGEDGFELSIPAEGARTIAEWLLDQDGVEPIGLGARDSLRLEAGLCLYGHDM
DKETTPIEASLGWAIGKARRQGGEREGGFPGADVILTQQANQDAERLRVGLKADGKAPVR
EGAKLFNMEGDPIGEVTSGTFGPSVGAPVAMGYIKRERCEPGQKLQAEVRGRRLDMTVTP
MPFVTTHYYRG
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaccctgcatcgaacgccgctctatacgctctggcaacagcgcgggggcagattt
gttcccttcgccggctatgaaatgcctgttcagttcgagatgggaatcaagcgtgagcat
gagcacacgcgtcaaaagtgcgggttgtttgatgtctcccatatgggacagatgctgatt
catggtagccagccggcaacggcgcttgagcgagtatcgccgatcgatgcggcgggtatt
gcccacggtcggcagcgttatggtctctttaccagcagtgttggcgggattcatgatgac
ttcatggcggtcaatgccggagagcatctctatctggtcgtcaatgctgcctgtcgtgcg
gcggatgcggccttgctaagaagcgggctgggtgaaggtggggacctcgaggtcgtcgag
gatcgtgcgctactggcgcttcaggggcccatggcgcgtgacgtcatgagtgatctgtgt
ccgtcggcgacagagctcaccttcatgcaacacgcccggttcgagatcatgggacatgag
gtctggatcagttgctcgggatataccggggaagatggttttgaactttccattcctgcc
gagggtgcccggacaattgccgagtggttgctggatcaggacggcgttgagcccatcggg
ctgggtgcgcgcgattcattgcgcctcgaagccgggctttgtctctatggtcacgacatg
gacaaggaaaccacgcccatcgaggcgtcgcttggctgggcgatcggcaaggcgcgacgt
cagggcggggagcgagaaggcggatttcctggcgcggatgtgattctgacccagcaggcc
aatcaggacgccgaacgcctgcgagtcgggttgaaggctgatggaaaagcgccggtgcgt
gagggggccaaacttttcaatatggaaggtgaccccatcggcgaggtgacctcgggcact
tttggcccatcggtcggagcacccgttgccatgggttatatcaaacgagagcgttgtgag
ccggggcaaaagctacaggcagaggtgcgcggacgtcggttggatatgacggtcacaccg
atgccctttgtcaccacccattactatcgtggctag

DBGET integrated database retrieval system