KEGG   Klebsiella michiganensis RC10: VW41_01665Help
Entry
VW41_01665        CDS       T03782                                 

Definition
(GenBank) aldehyde dismutase
  KO
K00148  glutathione-independent formaldehyde dehydrogenase [EC:1.2.1.46]
Organism
kmi  Klebsiella michiganensis RC10
Pathway
kmi00625  Chloroalkane and chloroalkene degradation
kmi00680  Methane metabolism
kmi01100  Metabolic pathways
kmi01120  Microbial metabolism in diverse environments
kmi01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:kmi00001]
 09100 Metabolism
  09102 Energy metabolism
   00680 Methane metabolism
    VW41_01665
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    VW41_01665
Enzymes [BR:kmi01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.46  formaldehyde dehydrogenase
     VW41_01665
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N
Motif
Other DBs
NCBI-ProteinID: AJZ87842
UniProt: A0A0D5WQD8
Position
complement(353574..354788)
Genome map
AA seq 404 aa AA seqDB search
MTPTGNRIVTFEKPLEMKVNTFKFPELITPQGKSAPHGAILKIVTTNICGSDLHIYRGSF
AVPKGMTMGHEMTGEVIEVGSDVEVVKKGDIVSVPFNVGCGRCYNCKHMRSDVCENTNPE
IDCGAYGFNLGGWTGGQGDYLFVPYADFNLLRFPDKDAAMEKIRDLTLLSDVLPTAFHGF
AGPDWPAAPAYVVGENILIFGAGPVGRAGAACARLLGAGAIIVADYIQERLDLLKPHGVE
TINLSDGVPIEEHLERITGHREVDRVIDYVGVDCRGFGAEADKIVESAVTNAMLKYVRFG
GMTSTVGVYCANPISKDPKAKKGHMDLEWSNAWIKSPRMSAGQSPTANYNHALMRAILND
RMPYLSPMMNTKFIKLEDAPAAYKEFDAGSAYKYVIDPHGSVRH
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgactccgaccggtaaccgaatcgtgactttcgagaagcccttggaaatgaaggtcaac
accttcaaatttccagagctgataacccctcaagggaaaagcgcaccccatggcgctatc
ctcaaaatagttaccacaaatatctgtggcagcgaccttcacatttatcgcggttcgttt
gctgttcccaagggaatgaccatgggccatgaaatgaccggcgaagtgatcgaagtggga
tcagacgtcgaagtcgtgaagaagggcgacatcgtttccgttcccttcaatgtggggtgt
gggcgttgctacaactgcaagcatatgcgctccgatgtatgcgagaacaccaaccccgaa
atcgactgcggagcctacgggttcaacctcggtggctggacgggggggcaaggtgattat
ctcttcgtaccgtatgcggatttcaatctccttcgcttccctgacaaggatgccgccatg
gaaaaaatccgcgacctgacccttctctctgacgtattacccacagctttccatgggttc
gctggcccggactggccagccgcaccggcctacgtcgtcggcgaaaacatcctgatcttc
ggtgccgggccggtcggcagagcgggtgccgcctgcgccagacttctgggtgcaggcgcc
atcatcgttgccgattacattcaagagcggctggaccttctcaagccacacggcgtggaa
accatcaacctttccgacggcgtgccgatcgaggagcatctcgaacgcattaccgggcac
agggaggtggatcgcgtcatcgactatgttggtgtggactgccgcgggtttggcgcggag
gctgacaagatcgtggagagcgctgttaccaacgcaatgctcaaatatgtccgcttcggc
ggaatgaccagtacggtcggtgtgtactgcgcaaacccgatctcgaaagacccgaaagcc
aagaaaggccatatggatctggaatggtccaacgcctggatcaagtcgccgcgaatgtcg
gctggtcaatctccgacggccaactacaaccacgcgttaatgcgggcgatactgaacgat
cgcatgccttacctttcgccgatgatgaacactaaattcatcaagctcgaagacgcgccc
gccgcgtacaaagagttcgacgcgggttctgcatacaagtacgtcatcgacccgcatggt
tcagtgcggcattaa

DBGET integrated database retrieval system