KEGG   Klebsiella michiganensis RC10: VW41_07030Help
Entry
VW41_07030        CDS       T03782                                 

Definition
(GenBank) threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
kmi  Klebsiella michiganensis RC10
Pathway
kmi00260  Glycine, serine and threonine metabolism
kmi01100  Metabolic pathways
kmi01110  Biosynthesis of secondary metabolites
kmi01120  Microbial metabolism in diverse environments
kmi01130  Biosynthesis of antibiotics
kmi01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:kmi00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    VW41_07030
Enzymes [BR:kmi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     VW41_07030
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_1_2 Aminotran_5 Cys_Met_Meta_PP DegT_DnrJ_EryC1
Motif
Other DBs
NCBI-ProteinID: AJZ88802
UniProt: A0A0D5WT43
Position
complement(1477182..1478183)
Genome map
AA seq 333 aa AA seqDB search
MIDLRSDTVTRPSRAMLEQMMAAPTGDDVYGDDPTVNELQAYAAKISGKEAALFLPTGTQ
ANLVALLSHCERGEEYIVGQAAHNYLYEAGGAAVLGSIQPQPIEADRDGTLPLDKVAAKI
KPDDIHFARTKLLSLENTHNGKVLPREYLAQAWEFSRKHNLALHVDGARIFNAVVSYGCQ
LEEITRYCDSFTICLSKGLGTPVGSLLVGSQDYIKRAIRWRKMTGGGMRQAGILAAAGLY
ALKNNVERLKEDHDNAHWLAGELREIGVDVMRQDTNMVFVRMTAEEAEDLGPYMRERGII
ISAGPATRLVTHLDVTRSQLAEVVAHWRSFLQN
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgatcgatttacgcagcgataccgttacccgcccttcccgcgccatgctggagcaaatg
atggccgccccgaccggggatgatgtttacggcgacgatccgaccgtcaacgagcttcag
gcatacgcggcaaaaatcagcggtaaagaagctgccctgtttttacccaccggcactcag
gccaacctcgtggctttgctaagccattgcgaacgtggcgaagagtatatcgttggccag
gccgcgcataactacctctacgaagccggcggcgcagcggtcctgggcagcattcagcct
cagcccattgaagcggatcgcgacggcacgctgccgctggataaagtggcggcaaaaatt
aaaccggacgacattcacttcgcccgcaccaaactgctgagcctggaaaacacccataat
ggcaaagtgctgccgcgcgaatacctcgcgcaggcctgggaattcagccgcaagcataac
ctggcgctgcacgttgacggcgcgcgtatctttaacgccgtggtgtcctacggctgtcag
ctggaagagattacccgctactgcgacagcttcactatttgcctgtcaaaaggcctgggc
acgccggtaggctccctgctggtcggcagccaggactacatcaagcgagcaatacgttgg
cgcaaaatgacgggcggcggtatgcgccaggccggcattctggcggcggctggcctgtat
gcgctgaaaaataacgttgagcgtctgaaagaagaccacgacaacgcccactggctggcc
ggtgagctgcgcgaaatcggcgtcgatgtgatgcgccaggataccaatatggtatttgta
cgcatgacggcggaagaagcggaagatttagggccatatatgcgcgagcgcggcataatc
atcagtgcaggcccggccacgcgtctggttacccatctggacgtcacccgcagccagttg
gctgaagtcgtcgcccactggcgcagcttcctgcaaaactaa

DBGET integrated database retrieval system