KEGG   Klebsiella michiganensis RC10: VW41_09735Help
Entry
VW41_09735        CDS       T03782                                 

Definition
(GenBank) UDP-4-amino-4-deoxy-L-arabinose formyltransferase
  KO
K10011  UDP-4-amino-4-deoxy-L-arabinose formyltransferase / UDP-glucuronic acid dehydrogenase (UDP-4-keto-hexauronic acid decarboxylating) [EC:2.1.2.13 1.1.1.305]
Organism
kmi  Klebsiella michiganensis RC10
Pathway
kmi00520  Amino sugar and nucleotide sugar metabolism
kmi01100  Metabolic pathways
kmi01503  Cationic antimicrobial peptide (CAMP) resistance
Module
kmi_M00761  Undecaprenylphosphate alpha-L-Ara4N biosynthesis, UDP-GlcA => undecaprenyl phosphate alpha-L-Ara4N
Brite
KEGG Orthology (KO) [BR:kmi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    VW41_09735
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01503 Cationic antimicrobial peptide (CAMP) resistance
    VW41_09735
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:kmi01005]
    VW41_09735
Enzymes [BR:kmi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.305  UDP-glucuronic acid dehydrogenase (UDP-4-keto-hexauronic acid decarboxylating)
     VW41_09735
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.13  UDP-4-amino-4-deoxy-L-arabinose formyltransferase
     VW41_09735
Lipopolysaccharide biosynthesis proteins [BR:kmi01005]
 Unusual sugar
  VW41_09735
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase Formyl_trans_N GDP_Man_Dehyd Formyl_trans_C 3Beta_HSD NAD_binding_10 Sacchrp_dh_NADP TrkA_N
Motif
Other DBs
NCBI-ProteinID: AJZ89298
UniProt: A0A0D5WTP9
Position
2052748..2054730
Genome map
AA seq 660 aa AA seqDB search
MKAVVFAYHDMGCVGVRALVEAGYDIAAIYTHPDNAAENNFFGSVARTAAEFGIPVFAPE
DVNHPLWVDRIKDAQPEVIFSFYYRNLLSEEILDCASVGAFNLHGSLLPKFRGRAPLNWV
LVKGETETGVTLHRMVKRADAGDIVAQERVAIAAEDTALTLHHKLCETAKSLLAKSLPVI
KTGHFPQTAQDEAKATYFGGRSPKDGAISWEGSAAEANNLVRAVTEPWPGAFSYVGGGKF
IIWKSRVLESNNGAKAGTVISVNPLVIACGTGALEVVTGQAENGVYMQGSQLAQSLGLVS
GAILSSKPVSAIKRRTRVLILGVNGFIGNHLTERLLRDDNFEIFGLDIGSDAISRFIGNE
RFHFVEGDISIHSEWIEYHIKKCDVVLPLVAIATPIEYTRNPLRVFELDFEENLKIIRDC
VKYKKRIIFPSTSEVYGMCTDKSFDEDNSPLIVGPINKQRWIYSVSKQLLDRVIWAYGEK
EGLRFTLFRPFNWMGPRLDNLNAARIGSSRAITQLILNLVEGSPIKLIDGGKQKRCFTDI
GDGIEALFRIIENKNNNCDGQIINIGNPENEASIKQLAEMLLESFERHPLRSQFPPFAGF
REVESSAYYGKGYQDVEHRKPSIRNAQRLLDWTPEVHMEKTIDETLDFFLKTVELTDPAS
NT seq 1983 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagttgttttcgcctatcacgatatgggctgtgtgggtgttcgtgccctggtt
gaagcaggctatgacattgcagcaatttatactcacccggataacgccgctgagaataac
ttctttggctctgtggcccgcacggcggcagaattcggcattccagtttttgctcctgaa
gatgtgaaccacccgctgtgggttgaccgcattaaagacgcgcagcctgaagtcattttc
tccttctactaccgcaacctgctgagcgaagagatcctggactgcgcttccgtaggcgcg
tttaacctccacggttctctgctgcctaaattccgcggtcgtgcaccgttgaactgggtg
ctggtaaaaggtgaaacggaaaccggcgtgactctgcaccgcatggtgaaacgtgcggat
gcgggcgacattgttgctcaggaacgcgtggcaattgcggcagaagataccgccctgacc
ctgcaccacaaactgtgcgaaaccgcaaaatccctgctggcgaaaagcctgccggtgatc
aaaaccggtcacttcccgcagaccgcacaggacgaagcaaaagccacctatttcggcggc
cgttcaccaaaggatggcgcgatcagctgggaaggctctgctgcagaagcgaacaatctg
gtacgtgcggtaactgaaccatggccaggcgcgttcagctacgtcggcggcggcaaattc
attatctggaaaagccgcgtgctggaaagcaacaacggtgcaaaagccgggacagttatc
tccgttaatccgctggtgattgcctgtggaaccggtgctctggaagtggttaccggccag
gctgaaaacggcgtgtacatgcagggctcccagctcgcgcagtcgttgggcctggtcagc
ggtgccattttgagcagcaagccggtgtccgctatcaagcgtcgtacccgcgtgcttatc
ctgggcgtgaacggcttcatcggtaaccacctgaccgaacgtctgctgcgcgatgacaac
ttcgaaattttcggtctggacatcggttctgacgctatttctcgcttcatcggtaacgag
cgtttccactttgtggaaggcgacatcagcatccactccgaatggatcgagtaccacatt
aagaaatgtgacgttgttctgccgctggtggctatcgcgacgccaatcgaatacacccgt
aacccactgcgcgtattcgaactcgacttcgaagagaacctgaagattatccgcgactgc
gtgaaatacaaaaaacgcattatcttcccgtccacgtccgaagtgtacggcatgtgcacc
gacaagtcgtttgacgaagataactccccgctgatcgttgggccaatcaacaagcaacgc
tggatctactccgtgtccaagcagctgcttgaccgggttatctgggcctacggtgaaaaa
gaagggctgcgcttcacgctgttccgtccgtttaactggatggggccgcgtctggacaac
ctgaacgccgcgcgtatcggtagctcccgtgcaattacccagcttatcctgaacctggtt
gaaggttctccgatcaagctcatcgacggcggtaagcagaagcgttgcttcaccgacatc
ggtgatggcatcgaagcgctgttccgcattattgaaaacaaaaacaataactgcgacggc
cagatcatcaacatcggtaacccggagaacgaagcgagcatcaaacagctggcagaaatg
ctgctggaaagcttcgaacgtcatccgcttcgcagccagttcccgccgtttgccggtttc
cgcgaagtggaaagcagcgcgtactacggtaaaggctatcaggacgttgaacaccgtaag
ccaagcatccgcaacgcgcagcgcctgctggactggacgcctgaagtccacatggaaaaa
accatcgacgaaacgctggacttcttcctgaaaaccgttgagctgacggaccctgcttca
tga

DBGET integrated database retrieval system