KEGG   Klebsiella michiganensis RC10: VW41_16825Help
Entry
VW41_16825        CDS       T03782                                 

Definition
(GenBank) glycosyl hydrolase family 32
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
kmi  Klebsiella michiganensis RC10
Pathway
kmi00052  Galactose metabolism
kmi00500  Starch and sucrose metabolism
kmi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kmi00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    VW41_16825
   00500 Starch and sucrose metabolism
    VW41_16825
Enzymes [BR:kmi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     VW41_16825
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C
Motif
Other DBs
NCBI-ProteinID: AJZ90569
UniProt: A0A0D5WWW3
Position
3651592..3653034
Genome map
AA seq 480 aa AA seqDB search
MNTPLNKAQSALETLQTARGNAFYPLYHLAPPAGWMNDPNGLIYHNGLYHAFYQHHPFDE
NWGPMHWGHATSRDMVRWKHQPIALAPGDEWDRDGCFSGCAVADNGVLSLIYTGHLWLAG
AGNDSAIRQVQCLATSEDGVHFQKQGVILTPPPGIMHFRDPKVWQQDGTWWMVIGARDEH
DRGKVLLYRGDSLHDWQLDRILAEANADMGYMWECPDFFPLGNSKILMFSPQGIKAKGWA
YQNLFQSGYLRGRWQPGEDFLPYQPFEEMDHGHDFYAPQSFVAEDGRRIVLGWMDMWESP
MPSKREGWAGCLTVPRELCMMPNGKLYQNPVHELATLRAREQLVLPCVLDTQKQMLHPNA
EAVELEIAWEAGQSTAERYGIRLGQGCELFVDALTRRLVLSRCYQDAQLDGDRSVPLSEN
GDLHLRIFIDRSSIEVFVNQGEYCLSSRLYPQPGERQLELFASHGKALCRGGTLWQLSAL
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atgaataccccactgaacaaggcgcaatccgccttagaaaccctgcaaacagcgcgcggc
aacgctttttatccgctctatcatctggcaccacccgcgggctggatgaacgaccctaac
ggcctgatttatcacaacgggctttaccacgccttctatcagcaccatccgttcgatgaa
aactgggggccaatgcattgggggcatgccaccagccgggatatggttcgctggaaacat
cagcccattgcgctggcaccaggagatgaatgggatcgcgatggctgtttctccggctgt
gcggtggccgataacggcgtgctctcgctgatttacaccggacatctctggctggctggt
gccggaaacgatagcgcgatacgccaggtgcaatgcctcgccaccagcgaagacggtgtt
cactttcagaaacaaggcgtcattctcaccccaccgcccggcatcatgcatttccgcgat
ccgaaggtatggcaacaggatggcacctggtggatggtcattggcgcccgagacgagcac
gatcgaggcaaggtattgctttatcgaggcgattcacttcatgactggcagttggatcgc
attctcgcggaagccaacgcggatatgggctatatgtgggaatgcccggacttcttcccg
ctcggaaacagcaagatcctgatgttttccccgcagggcatcaaggccaaaggctgggca
tatcagaatctgttccagagcggctatttgcgagggcgatggcaaccgggggaagatttc
ctaccttatcagccgtttgaagagatggatcacggccacgatttttacgccccgcagtcc
tttgtcgccgaagatggccgccgtatcgtgctgggatggatggacatgtgggaatctccc
atgccttctaaacgcgaaggctgggcgggttgccttaccgtgccacgcgaactgtgcatg
atgccaaacggcaaactttaccaaaatccggtgcacgaactggcaacgcttcgcgccagg
gagcaattggtgttgccctgcgtgctggacacgcaaaagcagatgctgcacccgaatgca
gaagccgtggaattagagatagcctgggaggccggacaaagcacggctgaacgctatggc
attcgcctgggacagggctgtgagctgtttgtcgatgcgctaacccggcgtctggtgctg
tcacgctgctatcaggacgcgcagctggacggcgatcgcagcgtgccgttatcggaaaac
ggcgacctgcatctgcggatttttatcgatcgatcttccatcgaagtctttgttaaccag
ggcgaatactgtctcagcagccgcctctaccctcagccaggggaacgtcaactggaactt
tttgccagccacgggaaagccttatgccggggcggcacgctgtggcaattgagcgcgtta
tag

DBGET integrated database retrieval system