KEGG   Kryptolebias marmoratus (mangrove rivulus): 108228306Help
Entry
108228306         CDS       T05608                                 

Definition
(RefSeq) beta-galactoside alpha-2,6-sialyltransferase 2-like
  KO
K00779  beta-galactoside alpha-2,6-sialyltransferase (sialyltransferase 2) [EC:2.4.99.1]
Organism
kmr  Kryptolebias marmoratus (mangrove rivulus)
Pathway
kmr00510  N-Glycan biosynthesis
kmr00514  Other types of O-glycan biosynthesis
kmr01100  Metabolic pathways
Module
kmr_M00075  N-glycan biosynthesis, complex type
Brite
KEGG Orthology (KO) [BR:kmr00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    108228306
   00514 Other types of O-glycan biosynthesis
    108228306
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:kmr01003]
    108228306
Enzymes [BR:kmr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.99  Transferring other glycosyl groups
    2.4.99.1  beta-galactoside alpha-(2,6)-sialyltransferase
     108228306
Glycosyltransferases [BR:kmr01003]
 Terminal extension
  Sialyltransferase
   108228306
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_transf_29
Motif
Other DBs
NCBI-GeneID: 108228306
NCBI-ProteinID: XP_017259340
Position
Unknown
AA seq 514 aa AA seqDB search
MLWCMRCRHRFICMAFLCVSLTLLYILYTEKSVPITNTVCGIRTQASAQHPAASDIQVLQ
GRDNLLFINPQRNSKVILGDHHRPILILSLLNPTLEDLDSLPKRATKVEELHESFATKFL
RPFIPSLMIMFGNWQEEDLSGNEEIRDRKEVNREEELNGKEEWSGKEEVNEREELNGNKE
LSDKKVWSGKKKLIKTEEQSDKEELNGRQELSGKEKWNVIKELFRKEKQNGKEELNGGEE
LSGKEEWSVIRELFEKEELRGKKQQSENEDLSDKKKLRGKKKLSGENEWNGEMQQSVNKG
LSGKTNWHGKQELSGKAGDGGHLHPPNKVHEVLKQKVWDDEMSSNMLGSEMKKLWQDYQN
INTYGVKLSSPGGVSSRLKLTGPELLCQLKEKVELTTLTSDLEPFSELPWASQLPGKQLT
SDVGPYKTCAVVSSAGALLKSRLGKEIDSHDAVIRFNGAPTRGFEEDVGSKTTIHLFNSK
VMAKDKYHFLSSPLYNSGVLVAWDPAPFSSDLTQ
NT seq 1542 nt NT seq  +upstreamnt  +downstreamnt
atgctgtggtgtatgaggtgtcgccacagattcatctgcatggccttcctctgcgtctca
ttaacgctgctctacatcctctacactgaaaagagtgttcccatcaccaacaccgtctgt
ggcattcgaacccaagccagcgctcagcatcctgcggcctcagatattcaggtgcttcag
ggcagagacaacctcctgttcattaatcctcagaggaattcaaaagtcattctaggtgac
catcatcgcccaatcctcatcctctccttactgaatccaacgcttgaggacttggattct
ctgccaaagcgagcaacaaaggtggaggagctccacgagtcttttgctacaaagtttctg
cgccccttcataccatctctgatgattatgtttggaaactggcaagaggaagacctgagt
ggcaatgaagagataagggacagaaaggaggtgaatagagaggaggagctaaatggaaag
gaggagtggagtggcaaggaggaggtgaatgaaagagaggagctgaatggaaataaggag
ctgagtgacaaaaaggtgtggagtggcaaaaagaagctgatcaaaacagaagaacagagt
gacaaagaggagctaaatgggagacaggagctgagtggaaaagaaaagtggaacgtcata
aaggagctgttcagaaaagaaaagcaaaatggaaaagaggagctaaatggaggagaggag
ctgagtggaaaagaggagtggagtgtcataagagagctgttcgaaaaagaagagctgagg
ggtaaaaagcagcaaagtgaaaatgaagatctgagtgacaaaaagaagctgagagggaaa
aagaagcttagtggggaaaatgagtggaatggggaaatgcagcagagtgtaaataagggg
ctgagtggcaaaacgaactggcatggcaaacaggagctaagtggaaaagcaggggatgga
ggacacctacacccccctaacaaggtgcatgaggtgttaaaacaaaaggtttgggatgat
gagatgtccagcaacatgctggggagcgaaatgaagaaactatggcaggactatcagaat
ataaacacttatggagtaaagttgtccagccctggtggtgtctccagcaggctgaaactt
accggtcctgagcttctctgccaacttaaagaaaaggtagaactcacaactttgacctct
gacctcgagcctttctcggagttgccctgggccagccagctgccagggaaacagctgacc
tctgatgttgggccttacaagacctgcgccgtggtgtcatcagccggggcgctcctcaag
tccagattaggcaaagagatagactctcatgatgcagtgatacggttcaatggtgcgcca
acccgtgggtttgaggaagatgtcgggtccaaaacgacaattcacctcttcaactctaag
gtgatggcaaaagataaatatcacttcttgtctagtcctttgtataactcaggtgttctg
gtggcgtgggaccccgcccctttttcttcagacctcactcag

DBGET integrated database retrieval system