KEGG   Kryptolebias marmoratus (mangrove rivulus): 108228667Help
Entry
108228667         CDS       T05608                                 

Definition
(RefSeq) leukotriene B4 receptor 1-like
  KO
K04296  leukotriene B4 receptor 1
Organism
kmr  Kryptolebias marmoratus (mangrove rivulus)
Pathway
kmr04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:kmr00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    108228667
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:kmr04030]
    108228667
G protein-coupled receptors [BR:kmr04030]
 Rhodopsin family
  Lipid
   Leukotriene
    108228667
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srv 7TM_GPCR_Sru DUF996 SLC3A2_N
Motif
Other DBs
NCBI-GeneID: 108228667
NCBI-ProteinID: XP_017259748
Position
Unknown
AA seq 317 aa AA seqDB search
MDQLNSTVATSNSSSPGLLPQPFWNSRRLVPAVLFSFCFSVGVPGNIAVIILRPNWEHMS
RLSQSLLLNLAVSDLLCLLTFPLLIDAYLHGWRVNLVSCKLLAYVVYCSIYCSQLTVTGL
SIQRYLLVVHQQDCQQVKKRLIVVLHWLVAFILSIPHLVVQQLVPNQQWTDCRAQYSSDA
QWVAVRLTETIPGIVSFITVVFSYIRISRKVNQAAFFNNPQTTRLITSIIVSFVVLWVPY
FTNNVLGIVAICLGHEGLKKFYLTSWDFLSSLTTINKCLNPLLYAFTSRKVCNVFQKQEP
MQQDQRMPDSATTAELS
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atggatcaacttaattccacagtggcgacttctaactcctcttctccaggacttctgcct
cagcctttctggaactccaggcgtctcgtccccgcagtgttattttctttctgcttcagt
gttggagttcctggaaacattgctgtcattattctcagacctaactgggagcacatgtcc
agactgagccagagtttgctgctgaatctggccgtgtctgacctgctctgcctgctgact
tttccactgctgattgatgcttacctccacggctggagagtcaatttggtgtcctgtaag
cttctagcgtatgttgtgtactgcagcatttattgcagccagctgactgtgactgggtta
agcatccagcgttacctcttggtggttcaccagcaagattgccaacaggtaaaaaaaaga
ctgatcgtggttctgcattggttggttgcttttatcttgtctattcctcacttggtggtt
cagcagctggtaccaaatcagcagtggacagactgcagagctcagtattcttctgatgcc
cagtgggtggctgtgcggctgacagagacaattccgggaattgtttcttttattactgta
gtgttttcatacattcgcataagtaggaaagttaatcaggcagcctttttcaacaatcct
cagacaactcgactgattaccagcatcattgtaagttttgttgtcctttgggttccatat
tttaccaataatgtgctgggtatagtagctatttgtcttggacatgagggacttaaaaag
ttttatttaacctcttgggactttctctcatcactaacaacgatcaacaaatgcctgaat
ccactcctgtatgcctttacctctcgcaaagtctgcaatgtttttcaaaaacaggaacca
atgcagcaggaccaaagaatgccagattccgctacaactgcagaactgtcataa

DBGET integrated database retrieval system