KEGG   Kryptolebias marmoratus (mangrove rivulus): 108229910Help
Entry
108229910         CDS       T05608                                 

Gene name
suclg1
Definition
(RefSeq) succinate--CoA ligase [ADP/GDP-forming] subunit alpha, mitochondrial
  KO
K01899  succinyl-CoA synthetase alpha subunit [EC:6.2.1.4 6.2.1.5]
Organism
kmr  Kryptolebias marmoratus (mangrove rivulus)
Pathway
kmr00020  Citrate cycle (TCA cycle)
kmr00640  Propanoate metabolism
kmr01100  Metabolic pathways
kmr01200  Carbon metabolism
Module
kmr_M00009  Citrate cycle (TCA cycle, Krebs cycle)
kmr_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:kmr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    108229910 (suclg1)
   00640 Propanoate metabolism
    108229910 (suclg1)
Enzymes [BR:kmr01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.4  succinate---CoA ligase (GDP-forming)
     108229910 (suclg1)
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     108229910 (suclg1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CoA_binding Ligase_CoA Succ_CoA_lig CoA_binding_2
Motif
Other DBs
NCBI-GeneID: 108229910
NCBI-ProteinID: XP_017261157
UniProt: A0A3Q2ZC34
Position
Unknown
AA seq 324 aa AA seqDB search
MSHSRLFARLLLQHSGVRHCYTGTRQNLYINKNTKVICQGFTGKQGTFHSQQSLDYGSQL
VGGVSPGKGGKTHLGLPVFNSVKEAKEGTGADATVIYVPPPFAAAAIIEAIDAEIPLAVC
ITEGIPQQDMVRVKHKLLRQGATRLIGPNCPGVINPGECKIGIMPGHIHKKGRIGIVSRS
GTLTYEAVHQTTQVGLGQSLCVGIGGDPFNGTNFIDCLEVFLQDPKTEGIILIGEIGGNA
EENAAEYLKEHNSGANAKPVVSFIAGLTAPPGRRMGHAGAIIAGGKGGAKEKIAALQSAG
VVVSMSPAQLGSTMFKEFEKRKML
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgtctcacagcaggttgtttgccaggctgcttttgcagcacagtggagtcagacactgt
tatacaggaacaagacagaacctctacatcaataagaacacaaaggtcatctgccagggt
ttcacagggaagcagggaacgtttcacagtcagcagtccctcgactacggctcccagtta
gtcggaggcgtttctcccggtaagggggggaagacgcacctcggcctgccagtcttcaac
tctgtcaaggaggcaaaggagggcacaggggcagatgccaccgtgatttatgttcctccg
ccgtttgcggcggcggccatcatcgaggccatagatgcagagatacctctggcggtgtgc
atcactgagggcatccctcagcaggacatggtgcgggtcaagcacaagctcctgcgccag
ggcgccacccgcctcataggccccaactgccccggggtcatcaaccctggagaatgcaag
attggcattatgcccgggcacattcacaaaaaaggcagaattggcattgtttccagatcg
ggaaccctgacatacgaagcggtgcaccaaaccacacaagtaggcctgggccagtcgctc
tgcgtgggcatcggcggcgatccatttaatggtacaaacttcatagactgcctggaggtg
ttcctgcaggacccaaagacagaaggcatcatccttatcggagagatcggagggaatgcc
gaggagaatgcggctgagtatctgaaagaacacaactctggagctaacgcgaagcccgtg
gtgtccttcatcgcggggctgacggctcctcccggccgcaggatgggtcacgctggggcc
attattgctggtggaaaaggtggcgccaaagagaagattgcagccctgcagtcagctgga
gttgtagtcagcatgtcccccgcgcagctgggaagtacaatgttcaaggagtttgagaag
aggaaaatgttgtaa

DBGET integrated database retrieval system