KEGG   Kryptolebias marmoratus (mangrove rivulus): 108230718Help
Entry
108230718         CDS       T05608                                 

Definition
(RefSeq) tumor necrosis factor ligand superfamily member 6-like
  KO
K04389  tumor necrosis factor ligand superfamily member 6
Organism
kmr  Kryptolebias marmoratus (mangrove rivulus)
Pathway
kmr04010  MAPK signaling pathway
kmr04060  Cytokine-cytokine receptor interaction
kmr04068  FoxO signaling pathway
kmr04210  Apoptosis
kmr04217  Necroptosis
kmr05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:kmr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    108230718
   04068 FoxO signaling pathway
    108230718
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    108230718
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    108230718
   04217 Necroptosis
    108230718
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    108230718
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:kmr04147]
    108230718
   04052 Cytokines and growth factors [BR:kmr04052]
    108230718
   04090 CD molecules [BR:kmr04090]
    108230718
Exosome [BR:kmr04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   108230718
Cytokines and growth factors [BR:kmr04052]
 Cytokines
  Tumor necrosis fators
   108230718
CD molecules [BR:kmr04090]
 Proteins
  108230718
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TNF C1q SusF_SusE DUF2681
Motif
Other DBs
NCBI-GeneID: 108230718
NCBI-ProteinID: XP_017262641
UniProt: A0A3Q3AIF7
Position
Unknown
AA seq 269 aa AA seqDB search
MNCDQRYPFPQVFLVDEGGGPRHSAQAPNLVPCWSFPPAVEKMRSRGKSRGCMGVSPSLA
MVVLMLFLLVFAALGFEAWQILQIQKKMKDTPADKVELQSVTEFDAPLKQIGLKPQSEED
KNRPAAHVIGRIEKESKLGNTLKWDSKVGRTFTSGGVAYRAEDGALQVNKSGLYHIYTRV
ELIFRQCTPSSSFEHSVFVRRAGYSSPLTLMQALRVGFCPQYTGHSWTSESYLGSAQQLQ
KDDKVFVNVTHRSLLSHTHYANFFGLYLL
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgaactgtgaccagaggtacccgttcccccaggtgtttcttgtagatgaaggtgggggt
ccacgccactctgcgcaggctcccaatctggttccctgctggtccttcccacccgccgtg
gagaagatgaggagtcgtgggaagagtcggggctgcatgggagtcagcccgagcctggcc
atggtcgtgctgatgctgttcctgcttgtgtttgcagctctggggttcgaagcctggcag
attttgcagatacagaaaaaaatgaaagacactcctgcagacaaggttgaacttcaatcc
gtgaccgagtttgatgctcctctgaagcaaattggtctcaaaccccaaagtgaagaagac
aaaaacagaccagcagcacatgtgattggtcggattgaaaaggaaagcaaattaggaaac
accttaaaatgggattcgaaggtgggtcggacgttcacctctggaggagtggcttacaga
gcagaagacggtgctctgcaggtcaacaagtctggactctaccacatttacacccgagtg
gagttgatctttaggcagtgcaccccttcatcctcattcgagcactctgtgtttgtgagg
agagcgggatactcctcacctttgactctgatgcaggccctgagggtgggattctgccct
cagtataccggtcattcctggacatcggaaagttacctgggctctgcccagcagctgcag
aaagacgacaaagtttttgtgaatgtaacgcaccgcagcttacttagtcacacgcattat
gccaacttttttggcctgtacctgctctga

DBGET integrated database retrieval system