KEGG   Kryptolebias marmoratus (mangrove rivulus): 108231423Help
Entry
108231423         CDS       T05608                                 

Definition
(RefSeq) transforming growth factor beta-2-like
  KO
K13376  transforming growth factor beta-2
Organism
kmr  Kryptolebias marmoratus (mangrove rivulus)
Pathway
kmr04010  MAPK signaling pathway
kmr04060  Cytokine-cytokine receptor interaction
kmr04068  FoxO signaling pathway
kmr04110  Cell cycle
kmr04218  Cellular senescence
kmr04350  TGF-beta signaling pathway
kmr04933  AGE-RAGE signaling pathway in diabetic complications
Brite
KEGG Orthology (KO) [BR:kmr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    108231423
   04350 TGF-beta signaling pathway
    108231423
   04068 FoxO signaling pathway
    108231423
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    108231423
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    108231423
   04218 Cellular senescence
    108231423
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    108231423
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:kmr04052]
    108231423
   00536 Glycosaminoglycan binding proteins [BR:kmr00536]
    108231423
Cytokines and growth factors [BR:kmr04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   108231423
Glycosaminoglycan binding proteins [BR:kmr00536]
 Heparan sulfate / Haparin
  Growth factors/receptors
   108231423
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TGFb_propeptide TGF_beta
Motif
Other DBs
NCBI-GeneID: 108231423
NCBI-ProteinID: XP_017263975
UniProt: A0A3Q2ZMY4
Position
Unknown
AA seq 419 aa AA seqDB search
MWLSCLPLLLLLRFSGVPLVEGINTCQSINLEAQKSRRIEAVRGQILSKLRIRSPPDDDD
DPPPGSVPPEVMLLYNSTRELLKERARLAESACERESSEEDYYAKEVQRIDMMPPRTDSN
AVQPAAPSLYYRVVHFDVNEVDLINSTLVKAEFRIFRAPNPQARSSEQRVELYQLLRPEE
DSTSTQRYIDSRTVQPRAKGVWISVDVTETVKDWVSDPENNLGLKLGVHCPCCTFVPSTN
NIVPNKSEELEALFAGVDDERLRLMRKQGQVKGQADFSTKTPHLILTLLPSDRVDNLARK
NRKKRAAATDTTTCSRGSDQGCCLRSLYIDFRRDLNWKWIHEPKGYKANFCAGNCPYLWS
VNNHYNMILPLYNKLNPEASATPCCVPQDLEPLTIMYFIGRTPRVEQLSNMVVKSCKCR
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atgtggctctcctgcctccccctcctgctgctgctgcggttctccggtgtcccgctcgtg
gaggggatcaacacgtgccagtccatcaacctggaggcgcagaagtcgcggcgcatcgag
gcggtccgcgggcagatcctcagcaagctgcgcatccgcagcccgccggacgacgacgac
gacccgccgccgggctccgtgccgccggaggtcatgctgctctacaacagcacgcgcgag
ctgctgaaggagcgcgcgcggcttgccgagtccgcgtgcgagcgcgagagcagcgaggag
gactactacgccaaggaggtgcagaggatcgacatgatgcccccccgcacggactcaaat
gctgtgcagccagcagcacccagcctttattaccgagtcgtccactttgacgtcaacgag
gtggacctgatcaacagcactctggtcaaggctgagttcaggatcttcagggctcccaac
cctcaggcccggtcctcggagcagagagtggagctctatcagctgctcagaccagaggag
gacagcacctccactcagcgctacatcgactcccgcaccgttcagccgagagccaagggg
gtctggatctctgtggacgtcacagaaaccgttaaggactgggtgtcagatccagagaac
aatcttgggctgaagctgggcgtccactgtccctgctgcaccttcgtcccgtccaccaac
aacatagtccccaacaaaagtgaggagctggaggcgctgtttgcgggtgtggacgatgag
cgtctccgtctgatgaggaaacaaggtcaggtcaaaggtcaggcggacttcagcaccaag
acgccgcacctcatcctcaccctgctgcccagcgacagagtggacaacctggccaggaag
aaccggaagaagagggcggccgccacggacaccacaacctgctcccgtggctcggatcag
ggctgctgcctgcgctcgctctacatcgacttcagacgggacctcaactggaagtggatc
cacgagccaaaaggctacaaagccaatttctgtgccggcaactgtccgtacctctggagt
gtcaacaaccactacaacatgatcctgcccctgtacaacaagctgaaccctgaggcctcg
gcgacgccctgctgtgttcctcaggacctggagcccctcaccatcatgtacttcataggc
cgcacgcctcgagtcgagcagctctccaacatggtggtcaaatcctgcaagtgccgctga

DBGET integrated database retrieval system