KEGG   Kryptolebias marmoratus (mangrove rivulus): 108231532
Entry
108231532         CDS       T05608                                 

Gene name
rdh5
Definition
(RefSeq) retinol dehydrogenase 5
  KO
K00061  11-cis-retinol dehydrogenase [EC:1.1.1.315]
Organism
kmr  Kryptolebias marmoratus (mangrove rivulus)
Pathway
kmr00830  Retinol metabolism
Brite
KEGG Orthology (KO) [BR:kmr00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    108231532 (rdh5)
Enzymes [BR:kmr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.315  11-cis-retinol dehydrogenase
     108231532 (rdh5)
SSDB
Motif
Pfam: adh_short adh_short_C2
Other DBs
NCBI-GeneID: 108231532
NCBI-ProteinID: XP_017264105
UniProt: A0A3Q3ASB9
AA seq 332 aa
MDIQFIYDILGEDAWYYITATFTVLWFLVWLYRDSLEIQGISEKYVFVTGCDTGFGNLLC
KKLDLRGFRVLAGCLTEKGADDLKRVSSSRLKTVLLDVTSQDSIQNAMEWTKKEVGDKGL
WGIVNNAGRSLPMGPSEWMKVEDFRSTLKVNMDGVIAMTVTFLPLIKKAHGRIVNVASVL
GRVAANGGGYSISKFAVECFSDCLRRDIHYFGIKVCIIEPGFFKTPVTNLETLERELHRL
WNQLSPEVKASYGDKYLDKFIMIQRLIMKVVCDSDLTKVTSCMEHALTAAHPRTRYSAGW
DAKLLWIPLSYMPSFVVDIALNLILPRPSKSV
NT seq 999 nt   +upstreamnt  +downstreamnt
atggatatacagtttatatatgatattttaggagaagatgcctggtattatatcactgcc
acctttacggtgttgtggtttcttgtgtggctgtacagagacagcctggagattcagggc
atctctgagaagtatgtctttgtgactggctgtgacacagggtttggaaaccttctgtgt
aaaaagctcgaccttagaggttttcgagtgctggccggctgtctcacggagaagggagcc
gatgatctgaaaagagtgtcgagttctcgtttgaaaactgtcctgctggacgtgaccagt
caggacagcattcagaacgccatggagtggaccaagaaggaggttggggataaaggactt
tggggtattgtgaacaatgctggacgctcattacccatgggtccttcagaatggatgaaa
gtggaggatttccgtagcactctaaaagtgaacatggatggagtgattgccatgacagtg
accttcctgccccttatcaaaaaggctcatggacgaattgtaaacgtagcatcagtactg
ggaagagtggctgcaaatgggggtggatacagtatctctaagtttgcagtggagtgtttc
tctgactgcctcaggagagatatacactacttcggaatcaaagtgtgcatcattgagcca
ggatttttcaagacgcctgtgaccaatcttgaaacccttgagagggagctgcatcgtctg
tggaatcagctcagccctgaagtaaaagccagctatggagacaagtacctggataagttt
attatgatccagcgtttgatcatgaaggttgtctgtgactcagaccttactaaagtaacc
agctgcatggagcacgctctgactgccgcccacccacgaacccgatacagcgccggctgg
gacgccaagcttctctggatccctctctcctacatgccttcatttgtagttgatatcgct
cttaatctgatactgccacggccctccaagagcgtttaa

DBGET integrated database retrieval system