KEGG   Kryptolebias marmoratus (mangrove rivulus): 108231761Help
Entry
108231761         CDS       T05608                                 

Gene name
mgat2
Definition
(RefSeq) alpha-1,6-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase isoform X1
  KO
K00736  alpha-1,6-mannosyl-glycoprotein beta-1,2-N-acetylglucosaminyltransferase [EC:2.4.1.143]
Organism
kmr  Kryptolebias marmoratus (mangrove rivulus)
Pathway
kmr00510  N-Glycan biosynthesis
kmr01100  Metabolic pathways
Module
kmr_M00075  N-glycan biosynthesis, complex type
Brite
KEGG Orthology (KO) [BR:kmr00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    108231761 (mgat2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:kmr01003]
    108231761 (mgat2)
Enzymes [BR:kmr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.143  alpha-1,6-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase
     108231761 (mgat2)
Glycosyltransferases [BR:kmr01003]
 Glycan extension
  N-Glycan
   108231761 (mgat2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MGAT2
Motif
Other DBs
NCBI-GeneID: 108231761
NCBI-ProteinID: XP_024860109
Position
Unknown
AA seq 479 aa AA seqDB search
MTFQQDRCLQQQLFLPTTNLPEITFSLCKAQESHSSSGRQKHESGSFPKELETVKRGGGS
SSSSSSSSVNNQIQVQATPAVSRAPVAPPNIQANDTHQEKAKDKGKPTKPEVDNTTLVYR
GIVFQLNFDQTIRNEEKFEKTRHKDDLVVVVQVHNRPDYLKLLVDSLRKARGVESVLLIF
SHDYWSPEINKVVASVDFCQVIQIFFPFSIQLYPQEFPGNDPRDCPRDIPKKDALKLGCI
NAEYPDSFGHYREAKFSQTKHHWWWKLHFVWDRVRALKDHQGLVLLIEEDHYLSPDFIHL
LKLMRALKREQCADCDILSLGSYSHIGYSSKANKVEVKLWKSTEHNMGMALSRDTYQRLL
RCTDTFCTYDDYNWDWSLQHLTVSCLPAYWKVMVSEAPRVFHAGDCGMHHKKASCMPTSQ
KTKIENVLQSSGNQLFPKNLLIAKRLPASGAGGVAPHVKNGGWGDIRDHELCKSYVRLQ
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atgacattccaacaggaccgatgtttacagcaacaattatttttgccaacaactaacctc
cctgagatcaccttttcattgtgcaaagcacaagaaagccactccagcagcggaaggcaa
aagcacgagagcggctcgttccccaaggagctggagacggtgaagaggggcggcggcagc
agcagcagcagcagtagtagcagcgtgaacaatcagatccaggtgcaagctactcctgcg
gttagccgggcgcctgttgcaccgcctaatatacaggcaaatgacacgcatcaggaaaaa
gcgaaggacaaaggcaaaccgacaaagcccgaggtggataacaccactttagtctaccgg
ggcattgtcttccagctgaattttgaccagacgataagaaacgaagagaagttcgagaaa
acccgacacaaagacgatctggtcgtggtagttcaggttcacaatcgacccgactacctc
aagctgttggtggacagtctgcggaaggccagaggcgtggagagcgtactgctgatattc
agccatgattactggtccccggagattaataaagtggtggcctctgttgacttctgtcag
gtcattcagattttcttccccttcagcattcagctgtacccacaggaattcccaggaaat
gaccccagggactgccccagagacattcccaaaaaggacgccttaaagctcggctgcatc
aacgcggagtacccggactccttcggccactaccgcgaggccaagttctcccagaccaaa
caccactggtggtggaagctgcactttgtgtgggaccgagtccgcgctctcaaagaccac
caaggcctggttctgttgattgaggaagaccactacctgtccccggacttcattcacctc
ttaaagctgatgagagctctgaaacgggagcagtgcgccgactgcgacatcctgtccctg
gggagctacagccacatcggctactccagcaaagccaacaaggtggaggtgaagctctgg
aagtccacggagcacaacatggggatggctctcagccgagacacgtaccagagactcctg
cggtgcacggacacgttctgcacgtacgacgactacaactgggactggtccttgcagcac
ctcaccgtgtcctgcctgcccgcctactggaaggtgatggtgagcgaggcgccgcgggtc
ttccacgcgggggactgcggcatgcaccacaagaaggcctcctgcatgcccaccagccag
aagaccaagattgagaacgtcctccagagcagcgggaaccagctgttccccaaaaacctc
ctaatcgcaaagagactgccggccagtggcgccggaggggtggccccgcatgtcaagaac
gggggctggggagacatcagggaccacgaactctgcaagagctacgtccgattacagtga

DBGET integrated database retrieval system