KEGG   Kryptolebias marmoratus (mangrove rivulus): 108232313Help
Entry
108232313         CDS       T05608                                 

Gene name
entpd3
Definition
(RefSeq) ectonucleoside triphosphate diphosphohydrolase 3
  KO
K01510  apyrase [EC:3.6.1.5]
Organism
kmr  Kryptolebias marmoratus (mangrove rivulus)
Pathway
kmr00230  Purine metabolism
kmr00240  Pyrimidine metabolism
kmr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kmr00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    108232313 (entpd3)
   00240 Pyrimidine metabolism
    108232313 (entpd3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:kmr04090]
    108232313 (entpd3)
Enzymes [BR:kmr01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.5  apyrase
     108232313 (entpd3)
CD molecules [BR:kmr04090]
 Proteins
  108232313 (entpd3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GDA1_CD39
Motif
Other DBs
NCBI-GeneID: 108232313
NCBI-ProteinID: XP_017265520
UniProt: A0A3Q3BDJ5
Position
Unknown
AA seq 500 aa AA seqDB search
MASKKKAGYKCRIAAVLFLLLAGIAALVTVAVIQSTLKSQEYSLEYGIVIDSGSSRSNVY
LYEWPGEKKNETGVVTEKMNCKVKGVAISEMKVNSTSDTETWKGFQYCISQIKENIPTEK
HRRTPLFLGATAGMRLLHQRDEQKSNEIMDSLREYLSSLPFDFRNASIMTGQEEGLYGWI
TVNYLKGNFLEKNLWNTYVHPHSSETVGSMDLGGASTQIAFQVQESRNGADYLKVKLYGY
PYTVYTHSFLCYGKNEADKRILDKIIQGSSNQSNIRNPCYPEGYSTTMKASDVYNTECTE
KPKNYNPNQNLFLFGDPDSRKCGEIVKSIFDFKNCLSSQCSFDGVEQPPVTGEFMAYAGF
FYLARALNLTGTSDLDQFKATVRNFCHTQWTVLKNEKEGINEKHLRTYCYGTHYVLTLLV
DGYKFDNETWKNIHFEKSIKETHIGWSLGYMLSLSNMIPSEVKEIPPLTNPVFAGLVFLF
SALIIVTAILVFIILIRTCY
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atggcttccaaaaagaaagcgggctacaagtgtcgtatagcagctgtgctgtttctcctg
ctggccggtatcgctgcccttgttactgttgctgtcatccagagcacattaaagagtcaa
gagtacagcttagagtatgggatagtgatagactctggttcgtcccgttccaatgtgtac
ctgtacgaatggccaggggagaagaagaacgagacaggagttgtgacagaaaaaatgaac
tgtaaagtaaaaggggtcgccatctcagagatgaaggttaattccacatcagacacagag
acatggaaaggattccaatattgtataagtcaaatcaaagaaaacattcctactgaaaag
cacagaagaacgcctctctttctgggagctacagctggaatgagactgctacatcagaga
gatgaacagaaatcaaatgaaatcatggatagtctcagagaatacttgagttcactgccc
tttgacttccggaatgcttccatcatgactggacaggaagaagggctgtatgggtggatc
acagtcaactacttgaagggaaatttcctggagaaaaatctatggaacacttatgtgcac
ccacacagctcagagacagttgggtcaatggaccttggtggagcatcaacacaaattgct
tttcaagttcaggaaagtagaaatggggctgactacttgaaggtcaaactgtatgggtac
ccctacactgtctacacacatagtttcctctgctatggaaaaaatgaagctgataagagg
attctcgacaaaatcatccagggatcatctaaccaatccaacatcagaaacccttgctac
cctgaaggatacagcaccaccatgaaagcctcagacgtttacaatacggagtgcacagag
aaacccaaaaactacaacccaaatcaaaatttgtttctgtttggggatccagactcaagg
aaatgtggagaaatagtaaagtccatatttgattttaaaaactgtttgtcatcccagtgt
tcctttgatggggttgagcagccaccggtcactggagaattcatggcatatgctggattc
ttctatcttgccagagctctaaatttaactggcacatcagatcttgaccagtttaaagcc
acagttaggaacttctgccacacacaatggactgtgctgaaaaatgaaaaagaagggata
aatgagaaacacctgcggacgtactgttatggcactcactatgtcctcactctcctggta
gatgggtacaagtttgacaacgagacctggaaaaacattcactttgaaaaatcaataaag
gaaacgcacattggctggagtttgggctacatgctgagtttgtccaatatgatcccatcg
gaggtgaaagaaatccccccgctgacaaaccctgtctttgctggccttgtctttttattt
tcagcattaatcattgtgactgctattctagtgtttatcatcctcattcgcacttgctac
tga

DBGET integrated database retrieval system