KEGG   Kryptolebias marmoratus (mangrove rivulus): 108232961
Entry
108232961         CDS       T05608                                 

Definition
(RefSeq) N-acyl-aromatic-L-amino acid amidohydrolase (carboxylate-forming) B-like
  KO
K18458  N-acyl-aromatic-L-amino acid amidohydrolase [EC:3.5.1.114]
Organism
kmr  Kryptolebias marmoratus (mangrove rivulus)
Brite
KEGG Orthology (KO) [BR:kmr00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    108232961
Enzymes [BR:kmr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.114  N-acyl-aromatic-L-amino acid amidohydrolase
     108232961
SSDB
Motif
Pfam: AstE_AspA
Other DBs
NCBI-GeneID: 108232961
NCBI-ProteinID: XP_024859640
Position
Unknown
AA seq 307 aa
MEQTSFPPMSRVAICGGTHGNELTGVYVVREMQKQKVDKLGSASVTAVLANPRATDVCRR
YIEKDLNRCFTDALLRSPITDSTPYELRRAQELNAQLGPKGSEEAVDLLIDLHNTTANMG
LCLIFYSLDWITLHIYKYIQSKMTNVPVRAIQLDVPMSDAYSLESVGKHGFAIEVGPQPN
GVLRADIFNAVKSAVDLTLTWLQEFSSGCTFEGGEVEAYTFAKHVDYPRDPAGEITAAVH
PELQDKDFKLLRSGDPVFLMFSGETVTHEGEELYPFFVNECAYYEKNIAFQLARRTTFTL
PSICLGN
NT seq 924 nt   +upstreamnt  +downstreamnt
atggagcagacctcgtttccaccgatgtccagggtggccatttgtggtggaacacatgga
aatgagctgacaggggtttacgttgtcagagaaatgcagaaacagaaggtggataaactg
gggtcggcttctgtaaccgctgtcctggcaaacccacgagccaccgatgtgtgcagaaga
tacattgagaaggatctcaaccgctgcttcacagacgccctgctgaggtcccccattaca
gactcgactccctacgagctgagacgagcccaggagctgaacgctcagctgggacccaaa
ggaagcgaagaggccgtcgatctgctcatagacctgcacaacaccaccgccaacatgggc
ctgtgtcttatcttctactctttagactggatcaccctgcacatttacaaatacatccag
agtaagatgactaatgtgcctgtaagagccatccagctggatgtaccgatgtctgacgct
tattccctggagtctgtgggaaaacacggctttgcaatagaagtggggcctcagcccaac
ggcgtgctcagagctgacatcttcaatgcggtgaaatcagcagtggatctcacgctaaca
tggctccaggagttcagctcaggatgcacctttgaagggggcgaagtggaagcgtacact
tttgcaaaacacgtcgactacccaagagatccagccggtgaaataactgctgccgtacac
cccgagctgcaggataaggactttaagctcctgcggtcgggggatccagtgttcctgatg
ttttctggggaaacggtgacgcacgagggagaggagctctaccccttcttcgtgaacgaa
tgtgcctactacgagaagaacattgctttccaattagctcggagaacgactttcacctta
ccatccatttgtttagggaactga

DBGET integrated database retrieval system