KEGG   Kryptolebias marmoratus (mangrove rivulus): 108233752
Entry
108233752         CDS       T05608                                 

Definition
(RefSeq) endoplasmic reticulum aminopeptidase 1-like
  KO
K09604  adipocyte-derived leucine aminopeptidase [EC:3.4.11.-]
Organism
kmr  Kryptolebias marmoratus (mangrove rivulus)
Brite
KEGG Orthology (KO) [BR:kmr00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:kmr01002]
    108233752
Enzymes [BR:kmr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.-  
     108233752
Peptidases and inhibitors [BR:kmr01002]
 Metallo peptidases
  Family M1
   108233752
SSDB
Motif
Pfam: Peptidase_M1 ERAP1_C Peptidase_M1_N ING Peptidase_M9_N
Other DBs
NCBI-GeneID: 108233752
NCBI-ProteinID: XP_017267899
UniProt: A0A3Q3F515
Position
Unknown
AA seq 938 aa
MFPLLLVLSVLCPPSSGAQIPNEGQPSDPPIATNGQRFPWDRMRLPQTVSPLHYDLTIHP
NLTTLDFTGVVRISLDVHEDTSVVILHAKQMQVSNVLLLAPGGARPLRVLEYPRFHQLAL
LSDSVLAKGRKYEVQLEFAANLSDSFHGFYKSSYRTSSGEVRVMASTQFEATFARGAFPC
FDEPAFKANFTIRITREPRHIAISNMPKVKTVELPGGLLEDHFDTTVKMSTYLVAYIVSD
FLSVSRTTQHGVQISIYSVPEKINQTAFALDAAVKLLDFYDDYFDIPYPLPKQDLAAIPD
FQSGAMENWGLTTYRETGLLFDPDKSSASDKLAITKVIAHELAHQWFGNLVTMEWWNDLW
LNEGFAKFMEFISLDITYPDLHVDNFFLGKCFEAMEVDSLSSSHPVSTPVENPTQIQEMF
DDVSYDKGACILNMLRDFLTPEAFEIGIIRYLKRFSYQNTVNSHLWESLTDICSSDDLDE
GRMKHVEFCSKRKLQSGASKWYSGDELDVKAIMDTWTLQEGFPLVTVEVRGREVRLSQER
FLRADDLSLTEGYLWQIPLTYQTSVSNTIHRFLLKTKTDVLYLPEEVDWVKFNVNMSGYY
MVHYAGEGWGSIINLLHHNHTALSGNDRASLIQNVFQLVGVGKVRLDTALELSLYLSRET
EIMAVTQGFGELVPLYKLMEKRDMPELENQMKGYIVDLFRDLINQQEWTDSGSVSQRVLR
SYLLLFACVRNYEPCLKKATRLFNQWKDSDGTMSLPVDITMAVFVVGARTPEGWNFLFEK
FRSSMQMSVRSRIKTAMTVTPLQDKLEWMMEQSLNGEVMKTQDLPDIVVSVARNPRGYKL
AWDFLRANWVTLIKKFDLGSNSVSYMVNGVTNQYSTREMLNEIRSFFDSLTEETGSKMRC
IQQTYETIEDNIRWMDTHLPLLEAWLNKRRHRTTHEDL
NT seq 2817 nt   +upstreamnt  +downstreamnt
atgtttcccctcctgttggtgctttctgtcctctgtcctccctcctccggagcccagatc
ccaaatgaaggccaacccagtgacccccccatcgccacaaacggtcagcgcttcccttgg
gaccggatgaggcttccccaaaccgtcagccccctgcactacgacctgaccatccaccca
aacctcaccaccctcgacttcaccggcgtggtccggatcagtctggatgtgcacgaggac
accagcgtggtgattctccacgccaagcagatgcaggtatccaacgtgctgctcctggcc
cccggtggcgcgaggcccctgagggtgctggagtatcctcgcttccaccagctggccctg
ctgtcggactcggtgctggccaaaggcaggaagtacgaggtccagctggagtttgctgcc
aacctgtccgacagctttcatggtttctacaaaagcagctaccgcaccagcagtggggag
gtccgggtcatggcatctacacagtttgaggctacatttgctcgtggagccttcccctgt
tttgacgagcccgccttcaaagccaacttcaccatacggatcacacgagagccacgtcac
atagccatttccaacatgcccaaggttaaaacagtggagctgcctggcggtttactggag
gatcactttgacacaacggtaaaaatgagtacttacctggtggcctacatcgtgtcagac
ttcctgtctgtgagcagaaccacgcagcacggagtccagatctccatttattctgtccct
gagaagatcaaccagacggcctttgctttggacgctgcagtcaagttgttggacttctat
gatgattatttcgacatcccttacccgcttcccaaacaggacctggcagccatccccgac
ttccagtctggtgcgatggagaactggggtctgaccacctacagagagaccggcctcctc
tttgaccccgacaagtcctccgcctccgacaaactggccatcacgaaggtcatcgcccat
gagctcgcacaccagtggtttggaaacctggtgacgatggagtggtggaatgacttgtgg
ctcaacgagggttttgccaagttcatggagtttatttccctcgacatcacttacccagat
ctgcatgtggataacttcttcttgggcaaatgttttgaagccatggaggtggactctctc
agctcatcccacccagtctccaccccagtggaaaaccccacgcagatccaggagatgttc
gacgacgtgtcatatgacaagggcgcgtgtattctgaacatgctgcgggacttcctaacc
cctgaggcctttgagatcggcatcatccgatacctgaagcgcttcagctaccagaacact
gtgaacagccacctgtgggagagcctgactgatatctgcagctcggatgatttggatgaa
ggtcgaatgaaacacgtggaattctgctccaaacggaaacttcagtctggagcctcgaag
tggtactctggcgatgagctggatgtcaaggccatcatggacacctggacgctgcaggaa
ggcttcccgctggtcactgtggaggtcagaggtcgcgaggtcagactcagtcaggagcgt
ttcctgagggccgatgacctgtcgctcactgaagggtacttgtggcagatccctctgacg
taccagaccagcgtgtccaacaccatccatcgtttccttctcaaaacaaaaaccgatgtc
ctgtacctgcctgaggaggtggactgggtgaagtttaatgtcaacatgagtggttactac
atggtccattatgcaggcgagggctggggttccataattaatctgctgcatcacaaccac
acggctctgtccggcaacgatagagccagcctcatccagaacgtcttccagctggtcggc
gttgggaaggtgaggctggacacggccctggagctgtctctttacctgtccagagagact
gagattatggctgtgactcagggctttggagaactcgttccactttacaagctgatggag
aagagagacatgcctgagctggagaaccagatgaaaggttacattgtggatctgttccgg
gatctgatcaatcagcaggagtggaccgactccggttcggtgtctcagcgagtgttgagg
agctacctgctgctgtttgcctgcgtcagaaactatgagccctgtttaaagaaagccact
cggctctttaaccagtggaaggattctgatggcaccatgagcctccccgtggatatcacg
atggccgtgtttgtggtcggagctcgcacgccagaggggtggaactttctgttcgagaag
ttccgcagctcgatgcagatgtctgtcaggagccgcataaagactgccatgaccgtcacc
ccgctgcaggacaagctcgagtggatgatggagcagagcctcaacggcgaagttatgaag
actcaggacctccctgacatagttgtgtctgttgccaggaaccctcgaggctacaaactg
gcctgggacttcctccgggccaactgggtcaccctgatcaagaagtttgacctcggctcc
aactctgtgtcctacatggtgaatggagtcaccaaccagtactccaccagggagatgctt
aatgagatccggagcttcttcgactcgctgaccgaagagaccggctcaaagatgaggtgc
atccagcagacctatgagaccatcgaggacaacatccgctggatggacacccacctcccc
ctgctggaggcttggctgaacaaacgcagacacagaacaactcacgaggatttatag

DBGET integrated database retrieval system