KEGG   Kryptolebias marmoratus (mangrove rivulus): 108233817
Entry
108233817         CDS       T05608                                 

Gene name
tm7sf2
Definition
(RefSeq) delta(14)-sterol reductase TM7SF2
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
kmr  Kryptolebias marmoratus (mangrove rivulus)
Pathway
kmr00100  Steroid biosynthesis
kmr01100  Metabolic pathways
Module
kmr_M00101  Cholesterol biosynthesis, squalene 2,3-epoxide => cholesterol
Brite
KEGG Orthology (KO) [BR:kmr00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    108233817 (tm7sf2)
Enzymes [BR:kmr01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     108233817 (tm7sf2)
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295 PEMT ICMT
Other DBs
NCBI-GeneID: 108233817
NCBI-ProteinID: XP_017268000
UniProt: A0A3Q3AGL5
AA seq 425 aa
MGPNGKALKHKLSHDTEREFGGTLGALCIPVFLPLTVLFLICTSRSPEASVLQWPPQLPS
TVQLWDPLAPVVLLGWIGLHALLYLMPFGKVSEGLLLRDGTRLKYPINGFSSLCISAVML
MLLLGLGAPLGYLFELLLPLAASAIAASFLFSIYLYIRSFWAPSHALALGGNTGNPLYDF
FIGRELNPRIGNFDLKYFCELRPGLIGWVVVNLGMLMEEVELRGSPSLAMILVNCFQLLY
VADALWNEEAVLTTMDIVHDGFGFMLVFGDLAWVPFTYSLQTAFLVKHPQTLSLFKAAVI
IALNGVGYYIFRKSNSQKNQFRRDLTHPSVAGLETIATATGKRLLVSGWWGLVRHPNYLG
DLLMALAWSLPCGFSHLLPYFYVVYFTVLLIHREARDERQCRAKYGLAWDTYCRRVPYRI
FPYIY
NT seq 1278 nt   +upstreamnt  +downstreamnt
atgggaccaaacggcaaggcactgaaacacaaactgtcacatgacacagaaagggagttt
ggaggaactctgggcgccctgtgcattcccgtgtttcttccgttgacggtgctcttcctc
atctgcacgagtcgatctcccgaggccagtgtgctccagtggccccctcagctgccctcc
acagttcagctctgggatcctctggcccctgtggtcctgctgggatggattggactccat
gccctgctctacttgatgccatttggaaaggtgtctgaaggattattgctgagggacgga
acgcgcctcaagtatcccataaatggtttcagcagtttgtgcatcagcgctgtgatgctg
atgttgttactggggctcggggctcctctcggttatctgtttgagctcctcctgcctctg
gcagcgtctgccatagcagcgtcgttcctgttctccatctacctctacatccgctcgttc
tgggccccttcccatgccttggccctcgggggaaacacaggaaatcccttgtatgacttc
ttcatcggacgggagctgaaccctcggattggaaactttgatctaaaatacttctgtgaa
ctcagaccaggtctgatcggctgggtggtcgtaaacctcgggatgctgatggaggaggtg
gagcttcgaggatccccctccctcgccatgatcctggtcaactgtttccagctgctttat
gtagctgatgctctgtggaatgaggaggctgttctgacaactatggatatcgtccatgat
ggttttggtttcatgctggtcttcggtgacctggcctgggtccccttcacgtacagcctg
cagactgccttcctggtgaagcacccacagaccctgagtctgttcaaggctgcagttatc
atagctctgaacggtgttggatattacatcttcagaaagtccaactcacagaagaaccag
ttcaggcgagacctgactcatccaagtgtcgcaggcctggagaccattgccacagcgacg
gggaaacggctgctcgtgtcaggctggtggggtctcgttcgtcatcccaattacctcggt
gacctccttatggcgctggcgtggtccctgccatgtgggttttcgcaccttttgccctac
ttctacgttgtttacttcaccgtcttgctgattcaccgagaggcccgggatgagaggcag
tgtcgggccaagtacggactggcctgggacacctactgtcgtcgtgtcccctacaggatc
ttcccgtacatctactga

DBGET integrated database retrieval system