KEGG   Kryptolebias marmoratus (mangrove rivulus): 108234099Help
Entry
108234099         CDS       T05608                                 

Definition
(RefSeq) glutathione S-transferase 3-like
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
kmr  Kryptolebias marmoratus (mangrove rivulus)
Pathway
kmr00480  Glutathione metabolism
kmr00980  Metabolism of xenobiotics by cytochrome P450
kmr00982  Drug metabolism - cytochrome P450
kmr00983  Drug metabolism - other enzymes
kmr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kmr00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    108234099
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    108234099
   00982 Drug metabolism - cytochrome P450
    108234099
   00983 Drug metabolism - other enzymes
    108234099
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:kmr02000]
    108234099
Enzymes [BR:kmr01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     108234099
Transporters [BR:kmr02000]
 Other transporters
  Pores ion channels [TC:1]
   108234099
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N GST_C GST_C_3 GST_N_3 GST_C_2
Motif
Other DBs
NCBI-GeneID: 108234099
NCBI-ProteinID: NP_001316272
UniProt: Q1EGE6
AA seq 221 aa AA seqDB search
MSGKVTLTYFNGRGKMESIRWLLTVAEVEFDEVFLTTREQYLKLLNDGALMFQQVPLVEI
DGLKLIQTKAILQYIAEKYNLHGKDIKDRVMVNMYSEGLTDLMELIMMLPFVPDPKPKLD
NIQTKAKERYMPVFEKALSGPVYLVGGKLSLADVLLLEATLMLEEKFPEILADFPNVKSF
QARMTLVPAISRFLQPGSKRKQQPDDHYKNTVMKVFNMTSL
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atgtctggaaaagttactctgacctatttcaacgggagggggaaaatggagtcaatccgt
tggctcctgactgttgcagaagtggaatttgatgaggttttcctgacaaccagagagcag
tacctgaaactcctgaacgatggggcgctcatgtttcaacaggttcctttggtggagatt
gacgggttgaaactcatccagacaaaggcaatcctgcagtacattgcagagaagtacaat
ctccacgggaaagatatcaaagaccgcgtcatggtcaatatgtactctgagggactgacg
gatcttatggaattgatcatgatgctgcccttcgtcccagaccccaaaccaaaacttgat
aacattcaaactaaagcaaaagagcgctacatgcctgtgtttgaaaaggcactgagtgga
cccgtgtacctggtgggaggtaaattaagccttgcagatgtgctgctgcttgaagccacc
ttgatgctggaggagaagtttcctgaaatcctcgcagacttccccaacgtcaagtctttc
caggccaggatgactctggtccccgccatcagcaggttcctgcagccgggcagcaagagg
aagcagcagccagatgatcattacaaaaacaccgtcatgaaagtgttcaacatgacgtca
ctgtaa

DBGET integrated database retrieval system