KEGG   Kryptolebias marmoratus (mangrove rivulus): 108234509
Entry
108234509         CDS       T05608                                 

Gene name
dguok
Definition
(RefSeq) deoxyguanosine kinase, mitochondrial
  KO
K00893  deoxycitidine kinase [EC:2.7.1.74]
Organism
kmr  Kryptolebias marmoratus (mangrove rivulus)
Pathway
kmr00230  Purine metabolism
kmr00240  Pyrimidine metabolism
kmr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kmr00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    108234509 (dguok)
   00240 Pyrimidine metabolism
    108234509 (dguok)
Enzymes [BR:kmr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.74  deoxycytidine kinase
     108234509 (dguok)
SSDB
Motif
Pfam: dNK AAA_33 AAA_18 AAA_17 DUF5674
Other DBs
NCBI-GeneID: 108234509
NCBI-ProteinID: XP_017269216
UniProt: A0A3Q3B4V8
AA seq 299 aa
MSALVRAARKHPALTPQVRRMSSYSFFQGGKTVDLQASFLSAVPQKTRCLSGSASRVKRV
SIEGNIAVGKSTFARLLQSACPDWEVVAEPVSKWQNIESKSSKGADAPPQTTVSNLLQMM
YQDPQRWSYTFQTYSCMSRLRTQLQPPPARLLSSKGTPVQVYERSVYSDRYIFALNMFEL
GCINATEWAVYQDWHSLLVEQFGHQVELEGIIYFRASPQKCMERLRRRGRPEENEVKLDY
LDKLHVQHERWLVEKSTEINFEKLKNIPVLQLDASVEFQSDPDVREQLVTKVKNFFNAL
NT seq 900 nt   +upstreamnt  +downstreamnt
atgtctgctctggttcgagctgctcgaaaacatccagctttgacgccgcaggtgaggagg
atgagctcctacagcttctttcaaggtgggaaaacagtcgacctgcaggcaagtttcctc
agtgctgtgcctcaaaagacgaggtgtttgtcaggttcagcgtcccgagtgaagagggtt
tctatcgagggcaacatcgctgttgggaagtcgacctttgcaagactcctgcagtctgct
tgtccagactgggaagttgtggctgaacctgtcagcaagtggcagaacatcgagagcaag
agctcaaagggagcagatgcgcctccccagacaacagtcagtaacctgctgcagatgatg
taccaggaccctcagcgctggtcgtacacatttcagacgtattcctgtatgagccggctg
agaacgcagctgcagccccctccggctcgcctgctcagctccaagggaacacctgtgcag
gtgtatgagcgctcagtctacagtgacaggtacatctttgctctgaatatgttcgagctg
ggttgcatcaatgccacagagtgggcagtctaccaggactggcactccctcctggtggag
cagtttggacaccaggtggagctggagggcatcatttacttcagagcctccccgcagaaa
tgtatggagcgtctgaggcgtcggggaaggccggaggagaacgaggtgaaactggactac
ctggacaagctgcatgttcagcacgagaggtggctggtggagaaaagcaccgagataaat
tttgagaagctgaaaaacattcccgtcttacaactcgatgccagtgtggagtttcagagt
gatccagatgtgcgggagcagttggtaacaaaggtgaagaacttctttaatgctttatga

DBGET integrated database retrieval system