KEGG   Kryptolebias marmoratus (mangrove rivulus): 108234558Help
Entry
108234558         CDS       T05608                                 

Gene name
ntrk2
Definition
(RefSeq) BDNF/NT-3 growth factors receptor isoform X1
  KO
K04360  neurotrophic tyrosine kinase receptor type 2 [EC:2.7.10.1]
Organism
kmr  Kryptolebias marmoratus (mangrove rivulus)
Pathway
kmr04010  MAPK signaling pathway
Brite
KEGG Orthology (KO) [BR:kmr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    108234558 (ntrk2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:kmr01001]
    108234558 (ntrk2)
Enzymes [BR:kmr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     108234558 (ntrk2)
Protein kinases [BR:kmr01001]
 Receptor tyrosine kinases (RTK)
  TRK family [OT]
   108234558 (ntrk2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase I-set Ig_3 LRR_8 Ig_2 TPKR_C2 LRR_5 TILa Haspin_kinase LRRNT
Motif
Other DBs
NCBI-GeneID: 108234558
NCBI-ProteinID: XP_017269309
Position
Unknown
AA seq 811 aa AA seqDB search
MRARRAGSGALSAPGRCLWWWVVAVGLTVGSGDPWMSSEACPSSCSCTSSRISCVDPERG
IGAFPVLQSEAEMENITDIYIANQSSFSSINDKDLHYYKNLRNLTVTNSRLTYVSKLAFQ
NNLKLQYLNLKDNNLSSLSWRIFKHLNISYLILSGNPLHCSCENMWIKLLLGEEADTQEL
RCIEDGGARKLMSKLKLPNCEVPMATLSPSKMPVKEWENVELFCTTSGMPRPELIWNMAL
ISNYEIETSGQISMMRLSNLSSLDHNSKITCIAENIVGGRESSLLLDILFPPKITKLSDA
ISDHHWCIPFSVAANPQPHFRWYHGDKEVQEGEYIMTMIHDVTEREYHGCLQLDNPTHVL
NGMYTLEVRNEYGVDRKQIEAHFMQQPWGEGPYSSEPYYYESTQDPPPADPPEDRVAVYV
VVGIAAVAFTGFLLMLVILRFGGNSKFGIKGPSSVISNDDDSASPLHHVSNGSNTPSSSE
MGPDAVIIGMTKIPVIENPQYFRSTNSLLKTDTFVQHIKRHNIVLKRELGEGAFGKVFLA
ECYNLSPDQEKILVAVKTLKEASENARKDFHREAELLTNLQHEHIVTFYGVCVESDPLIM
VFEYMKHGDLNKFLRAHGPDAVLMAEGQTTRPVELTQSQMLHIAQQIASGMVYLASQHFV
HRDLATRNCLVGENLLVKIGDFGMSRDVYSTDYYRVGVGGHTMLPIRWMPPESIMYRKFT
TESDVWSLGVVLWEIFTYGKQPWYQLSNNEVIECITQGRVLQRPRTCPKEVYDLMLGCWQ
REPHMRLNIKEIHGLLLNLAKASPVYLDILG
NT seq 2436 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgcccggagagccgggagcggggctctctccgcgccggggcggtgcttgtggtgg
tgggtcgtggcggtcgggctgacggtgggctcgggggatccgtggatgtcctcggaggct
tgcccctcgtcctgctcgtgcaccagcagcaggatctcctgcgtggacccggagcggggc
atcggcgcgttccccgtcctgcagagcgaggcggagatggagaacatcaccgacatctac
atcgccaaccagagcagcttctcctccattaacgacaaagacctgcactactacaagaac
ctcaggaacctaacggtgaccaacagcaggttaacatatgtttcaaagctggcctttcag
aacaacctaaagctgcaatatctgaatttgaaagataacaacctgtcatctctgtcctgg
aggatattcaaacacctcaacatctcatatctgatcctgtcagggaaccctctgcactgc
tcctgtgagaacatgtggatcaagctgttgttaggagaggaagcagacactcaagagctg
cgctgcatcgaggatggaggagcacgcaagctgatgtccaaactgaaactacctaactgt
gaggttcccatggcaacgctgagcccatccaaaatgcccgtaaaggaatgggagaacgtg
gagctgttctgtaccacctccggtatgcccaggcctgagctgatctggaacatggcactg
atatctaactacgagatcgagacatcaggccagatttcgatgatgcggctgtccaacctg
tcgtccctggatcacaacagtaaaatcacctgcatagctgaaaacattgttggagggagg
gagtcgtcgctgctgcttgatatactctttccacctaaaatcacaaaactgagtgatgca
atctcagaccatcactggtgtatccccttcagtgtggcagcaaacccccaaccacatttt
aggtggtatcacggtgataaagaggtgcaggaaggcgagtacatcatgacgatgatccat
gacgtcacagagagagagtaccacggctgcctgcagctggacaaccctacacacgtcctc
aacgggatgtacacgctggaggttcgaaatgagtacggggtcgaccgaaagcagattgaa
gcgcacttcatgcaacagccctggggggagggtccgtatagttcagagccttactactat
gaatcaacccaagaccctccacctgcggacccacctgaggacagagtcgctgtgtacgtg
gtggtgggcatcgctgctgtcgccttcactggtttcctgctcatgttggttattctcagg
tttggaggaaactccaagtttggcatcaaaggaccatcttcagtgatcagcaacgatgat
gactcagcttctcctcttcaccacgtctctaatggcagcaacacgccctcctcctcagaa
atgggcccggacgctgtcatcattggcatgacgaagatccctgtgatagagaacccccag
tacttcaggagcaccaacagcctgctcaagactgacacattcgttcagcacattaagaga
cacaacattgtgttgaagagggagctgggagaaggagcctttggaaaagttttcctggct
gaatgttacaacctgtcaccagaccaggagaaaatactggtggccgtcaagacacttaaa
gaggccagtgaaaatgccaggaaggatttccaccgtgaagcggagctgctgaccaacctg
cagcacgagcacatcgtcacgttctatggagtctgcgtggagagcgaccctctcatcatg
gtgtttgagtacatgaaacacggggacctgaacaagttcctcagggctcatggtccagat
gccgttctgatggcagaaggccagactaccagacctgtggagctgacccagtctcagatg
ctgcacattgcccagcagatagcatctggtatggtctacctggcttcacagcacttcgtg
caccgcgacttggccaccaggaactgtctggttggtgagaacctgctggtaaagatcgga
gactttggcatgtccagagacgtctacagcactgactactacagggtaggtgtgggaggt
cacaccatgctgcccatccgctggatgccccctgaaagcatcatgtacaggaagttcaca
acagaaagtgatgtttggagtctaggagttgtcctctgggagatcttcacctatggaaaa
cagccttggtatcagctctccaataatgaggtgatagagtgtataactcaaggtcgggtg
ctgcagcgcccccggacctgtcccaaagaagtgtacgacctgatgctgggctgctggcag
agggagccgcacatgagactcaacattaaagaaatccacggtctgctcctcaacctggcc
aaggcctcgcctgtatacctggatattctgggctga

DBGET integrated database retrieval system