KEGG   Kryptolebias marmoratus (mangrove rivulus): 108235258
Entry
108235258         CDS       T05608                                 

Definition
(RefSeq) uncharacterized protein LOC108235258
  KO
K09094  aryl hydrocarbon receptor repressor
Organism
kmr  Kryptolebias marmoratus (mangrove rivulus)
Brite
KEGG Orthology (KO) [BR:kmr00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:kmr03000]
    108235258
Transcription factors [BR:kmr03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    108235258
SSDB
Motif
Pfam: PAS HLH PAS_9 PAS_3
Other DBs
NCBI-GeneID: 108235258
NCBI-ProteinID: XP_017270643
UniProt: A0A3Q3EUH7
Position
Unknown
AA seq 680 aa
MIPPGDCMYAGRKRRKPIQKQKPSLANEKSNPSKRHRDRLNAELDRLASLLPFAPDVISK
LDKLSVLRLAVSYLRVKSFFQANQDKTSRKHITSPASSNPEPRKGSLQLGATINESSLLL
ESLTGFALVVSSDGMVFYASSTIVDYLGFHQTDVMHQNIFDYIHIDDRQEFRRQLHWSMC
PPQHQGGSGPQENQLAAGTDEDFVVSSMFNSPDAGEVSPELSCFLNRCFIARVRCLLDST
SGFLTMQFQGRLKFLHGQKKKSSSGTPVPPQLALFCIAVPFLLPSITEMKVKNILMRGKN
KGGGIISAMDHGDCGEHLRRHSINGGMSDITDPLFSCPHPGATQRGHRTPWTPLCKDNLK
YSPDGYYNQEEPLNYCKSSMAVHKGVGTGMGGGWPSRQHSGPVRAAQGVGYIPSNRLNRT
GQYGKPYRHSPSCHNGQGGEVFVSKLYGNVQIPTDPDFYCVDLVKCENDYGECYDSHLMP
DMQPIKVEHDSDSENGCDTYGQTWAVDRRYGNGMYDPSSGLQLKSETEYYDPQYSPCQRG
KTGISPPYNNGNYQNYAVNNGGGNATRLPKCDKDMGGNGDSSQFSPQKLSHSDSLCNNQS
VNLMDSNVYSHKTYMHPDYNKHYEFKGQGLIHSIKREPMDSPPWSENGHDINQSMMAGQR
NVMPCVMSTGHKSSPYVYMQ
NT seq 2043 nt   +upstreamnt  +downstreamnt
atgatccctccgggagactgcatgtacgcgggcagaaagaggaggaaacccatccagaaa
cagaagccgtccttggccaacgagaaaagcaacccgtccaagcggcaccgggaccggctg
aacgccgagctggaccggctggccagcctgctgccgttcgccccagacgtcatctccaag
ctggacaagctgtcggtgctgcgcctcgccgtctcctacctccgcgtcaagagtttcttc
caagcaaatcaagacaagacttccaggaagcacatcaccagcccagcatcctctaaccct
gaacccaggaaaggaagccttcagctgggcgccaccatcaatgaaagcagcctcctcctg
gaatctctgacaggctttgccctggtggtgagcagtgatgggatggttttctacgcctcc
tccaccatcgtggactacctggggtttcaccagaccgacgtgatgcaccagaacatcttt
gactacatccacatcgacgaccggcaggagttcagacgccagctccactggtccatgtgc
cctccacaacaccagggggggtctggaccacaggagaaccagctagctgcagggaccgat
gaggactttgtggtgagcagcatgttcaactctccagacgcaggagaagtttctcctgag
ctctcctgcttcctcaacagatgcttcatcgccagagttcgatgtctcttggacagcacc
tctggattcttgaccatgcagttccaaggtcggctaaagttcctccacgggcagaagaag
aagtcatcctcggggacgccagtacccccccagctcgctcttttctgcatcgccgttcct
ttcttactgccctccatcaccgagatgaaagtgaaaaatattttaatgcggggaaaaaac
aaaggaggagggattatctctgcaatggatcatggagactgtggagaacatctaaggagg
cactccatcaatggagggatgagtgacatcacagacccccttttttcctgtccccatccg
ggcgctacacagcgaggccaccgcactccctggactcctctctgcaaagacaacctcaag
tacagtcctgacggctactacaaccaggaggagcccctcaactactgcaagtcctccatg
gcggtccataaaggcgtcgggaccggcatggggggcgggtggccttcccggcagcactca
ggtcccgttagagcagctcagggagttggctacatcccctcaaaccgcttgaacaggact
ggccagtacgggaagccttaccgccattctccgagctgtcacaacggtcaagggggtgag
gtgttcgtctccaagctctacgggaacgtccagattccgacggacccggatttttactgc
gtggatctggtgaagtgcgagaacgactacggcgaatgctacgacagccatctgatgccc
gatatgcaacccatcaaggtggagcacgactccgactcagagaacgggtgcgacacgtat
gggcaaacctgggccgtcgaccgtcgctacggtaacgggatgtatgacccaagctctggc
ttacaactcaaatcagagacagaatattacgatccacagtactcaccctgtcagcgagga
aaaacaggaattagcccgccgtacaacaacggcaactaccaaaactatgcagtcaacaac
ggcgggggcaacgccacacgcctgccgaagtgcgacaaagacatgggcggcaacggcgac
tcgagccagttcagtcctcagaaactctcccactcagactccctatgcaacaaccaatcc
gtcaacctcatggactcgaacgtctactcgcacaagacctacatgcatccggactacaac
aagcattatgagttcaaaggtcaaggcttgatccattcgattaaacgggagcccatggac
tcacccccttggtctgagaatggtcatgacatcaaccagtccatgatggccggccaaagg
aacgttatgccatgtgtgatgagcacgggccacaaatccagtccttatgtttatatgcag
taa

DBGET integrated database retrieval system