KEGG   Kryptolebias marmoratus (mangrove rivulus): 108236553
Entry
108236553         CDS       T05608                                 

Gene name
adamts13
Definition
(RefSeq) A disintegrin and metalloproteinase with thrombospondin motifs 13
  KO
K08627  a disintegrin and metalloproteinase with thrombospondin motifs 13 [EC:3.4.24.87]
Organism
kmr  Kryptolebias marmoratus (mangrove rivulus)
Brite
KEGG Orthology (KO) [BR:kmr00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:kmr01002]
    108236553 (adamts13)
Enzymes [BR:kmr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.87  ADAMTS13 endopeptidase
     108236553 (adamts13)
Peptidases and inhibitors [BR:kmr01002]
 Metallo peptidases
  Family M12: astacin/adamalysin family
   108236553 (adamts13)
SSDB
Motif
Pfam: TSP1_ADAMTS TSP_1 Reprolysin ADAM_CR_2 TSP1_CCN TSP1_spondin Reprolysin_3 Reprolysin_4 ADAM_spacer1 Reprolysin_5 Peptidase_M10 Reprolysin_2
Other DBs
NCBI-GeneID: 108236553
NCBI-ProteinID: XP_017272772
AA seq 1378 aa
MVFMTPLCLLLLLPGFGPSMGYPQSKKLDDLATIPGDVLSSSGSSADSSVSGRLRRSTLL
PDITHLELLVVVGPDVQQVHKQDTERYTLTNLNIASELLRDVTLGANMRVHLVRMIILSE
PEPEIQMSSDIMASLRSVCDWGRRINPPNDTDPLHADLLLYITRFDLELPDGNKQVRGVT
QLGGVCSSEWSCVITEDTGFDLGITIAHELGHSLGINHDGMENTCSWSGFMMASDGGYNS
VDLTWSSCSRQQLLTFFSEGKAECVKDLPALRGSLQDWKPGLYYGVDDQCRIAFGSTARA
CSFTSPDLAACRVLSCHLEPDDDSSCKRLLVPLLDGTECAPDQWCLKGHCVSPHNFGSSV
VVNGSWSGWSEFSSCSRMCGGGVTRRTRQCNNPRPAFGGRGCEGPDIEAELCHQQPCERT
QLDFMAEQCSQTDPDPLYLQPNTASFYKWIPALGFVKGDEQCRYMCQSEGENFIVSRGSH
FVDGTRCEADSPPPFGATAACLQGRCRLFGCDGALRSGKVRDVCGVCDGDGSTCSLTSDS
YSGGQAKEYSTFLTLPVNATRVHIVNMAPLFTHLAVTVGGRYVVAGSGSMALNITHPSPL
DENHLEYRLHLTPDLLPETEEVTANGPLKQEINIQVYRKYGKEYGEKTNPNISYWFYVPA
RNSNLIDVTPEGKWAVFTTPCSVSCGSGVQKHEFVCVDENMNQLQQRHCKAPPPTAPLHT
TCQLTACPPRWDAGNFGACSASCGGGVRVRSVRCVQKHASDLVPVPESECPPDAAPHSAE
KCNLRLCPARWRVSEPGNCSAVCGPGEAKRVVSCVRQEDGRDVEVDQRSCLKQIRPADFV
PCVVDVCPVGWESEGEGLAVLKPGLSPRSGQAPVFVWSPVVSQCSKTCGNGTLQVWFSCV
DHRSRQGVPDFNCDASTKPDPQTEICGTSSCPAMWRSKHGVCSVTCGGGVANRVLYCAGE
VEGQEEVVDDASCSDFPKPAAVVSCNTHSCPARWKVVSTSPCSVSCDLGIATRNVSCVQF
IRGKESAVSEDRCRAVVKPATATPCLVKVCTYRWEVKPWSQCSVPCGYGIQSRAVSCMGP
SKPEPLSPLFCMHMPKPITIQGCDRGSCGDVTSAAAAAKTNLTRSPLPSPTLGHKDEAPA
GATEAVAAPSTTVPTPTPEPSACGQLLLEESGTVDLRDVRSRCTVSIGRPLDEVIHIKVT
SSSLSCRKKEYVAFFDRLAFVRKCAQVAGSELTTRTNVLLVRQNLFTPGSGVAFTYSSQK
NAKRSHHRDCDIQLFSPSGVFENPLTSNTNHTCRVLINAPPSVKIRIQALHIGLVFNATN
SRSTYIMIRDMDVLKTNVFNGRQLFLWRSSGNMAEVEFHGDYLHTKGTFRAEYSFVHL
NT seq 4137 nt   +upstreamnt  +downstreamnt
atggttttcatgactccactctgtcttctactcctgctgcctggcttcggcccttcaatg
ggatatccacagagcaagaagcttgacgatctcgccactattccaggagacgtgctctcc
tcttcaggatcttctgctgactcttcagtaagcggccgtctgcgacgctccactctgctc
cctgatatcactcacctggagctgttggtggtggtgggacctgatgtccagcaggtccac
aagcaggacacagaaagatacaccctcactaatctcaacattgcctcggagctgctgaga
gacgtgactctgggcgccaacatgagggtgcacctggtgcgcatgatcatcctgtcagag
ccagagccagaaatccaaatgtcctcggacatcatggcttccctcagaagtgtgtgcgac
tggggccgaaggatcaacccccccaacgacacggatccgctgcacgccgatctcctgttg
tatattacaaggtttgacctggagctgcctgacgggaacaagcaggtcaggggagtaacc
cagctgggaggggtttgctccagtgagtggagctgtgtgattacggaggacacgggcttc
gacctgggcatcaccatcgctcatgaacttggtcacagtttggggatcaaccacgatgga
atggagaacacctgcagctggagcggcttcatgatggcctctgacggaggctacaacagc
gtggatctgacctggtcctcctgcagcaggcagcagctcctcacgttcttcagtgaagga
aaagcagaatgtgttaaagatttgcctgcgctgagaggctccctgcaggactggaagccg
ggcctgtattatggcgttgatgaccagtgtcgtatagctttcggcagcacggcgagggcc
tgctcattcaccagtcccgacctggcggcgtgtcgtgttctgtcctgtcaccttgaacct
gacgatgacagctcctgcaaacgcctcctggttcccctgctggacgggacagagtgtgct
ccggatcagtggtgtctaaagggccactgtgtgtccccacacaattttggctcctctgtc
gtcgtcaatggctcctggtccggctggtctgagttctcctcctgttcacggatgtgcggt
gggggggtcacacgccgcacgcggcaatgcaacaacccaagacctgcttttggagggcgg
ggttgtgagggtccagatattgaggccgaactttgtcaccagcagccttgtgagcgcacc
cagctggacttcatggcggagcagtgttcccaaaccgaccccgaccccctctaccttcaa
ccaaacaccgcctcgttctacaaatggatccctgctcttggcttcgtaaaaggggatgag
cagtgcagatatatgtgccagtcggaaggagagaacttcatagtgagccgtggttctcac
tttgtggatgggactcgctgtgaggccgacagccctcctcctttcggcgcaacagctgct
tgtctacaaggcagatgccggctgtttggctgtgacggggcgctgcgctctggaaaagtg
cgggacgtttgtggggtgtgtgatggcgatgggtcgacctgcagcttgacatctgactcc
tacagtggcggtcaggccaaagagtacagcacattcctcactctgccagtgaacgcaaca
cgggttcacattgtcaacatggctcctctcttcactcatctggctgtaacggttgggggt
cggtacgtcgtggctggatcgggcagcatggctctgaatatcacccatccctccccgctg
gatgaaaaccacctggagtaccgcctccacctgacccctgaccttctacctgagacggaa
gaggtgacggcgaacggacctctgaaacaggagataaatatacaggtctatcgtaaatac
gggaaggaatatggggagaaaacaaatccaaacatcagctattggttttatgtacctgcc
aggaacagcaacttgatagatgttacacctgaaggcaaatgggctgttttcacaacacct
tgctccgtctcgtgtggatcaggtgttcagaagcatgagtttgtctgtgtagacgaaaat
atgaaccagttgcagcaacgtcactgcaaagcgcctcctccaactgcaccactccacaca
acctgtcagctcacagcctgtccccccaggtgggatgcagggaactttggagcttgtagc
gcctcctgtggagggggagttcgggtgcgttctgtgcgatgtgttcaaaaacacgcatcg
gatttagtaccggttccagagtctgaatgtccccctgatgctgctccacactctgctgaa
aagtgcaacctgcgcctctgtcctgccagatggcgcgtgtcagagccagggaactgctct
gcagtgtgtgggccaggggaggcgaaacgcgtcgtgtcctgcgttcggcaagaagacggt
cgggatgttgaagtggatcaacgctcgtgtttgaagcagatcagaccagctgattttgtg
ccatgtgtggtcgatgtctgcccagttgggtgggaatctgagggggaggggttggctgtc
ttgaagcctggcttgtcaccacgctccggtcaggctcctgtgtttgtgtggagccctgtt
gtcagccagtgttcaaagacttgtggcaacggaacactgcaggtgtggttttcctgtgtg
gatcaccggtccagacagggcgttcctgacttcaactgtgacgcttctaccaagcctgat
cctcagactgagatctgcggcacttcttcctgccccgcaatgtggcgctctaagcacgga
gtctgcagtgtgacgtgtggaggaggggtggcaaaccgggtgctgtactgtgccggagag
gtggagggacaggaggaggtggtggacgacgccagctgcagtgactttcccaaacctgca
gcagtggtttcttgtaatactcacagctgtcctgcaaggtggaaggttgtcagcacatcc
ccctgctctgtctcctgcgacctgggtatagctaccaggaacgtgtcctgtgtccagttt
atccgtggcaaggagagtgcggtgtcagaggatcgctgccgggcagtcgtcaaaccggcc
accgccacaccctgcctggtgaaagtctgcacctacaggtgggaggtgaagccgtggagc
cagtgttcagtgccctgtggatatggcatccagtcgagagccgtctcctgcatgggcccc
tccaagccggagcccctcagccccctgttttgtatgcacatgcccaagccaatcaccatc
cagggctgcgacaggggcagctgcggagatgtgacctccgccgccgcagctgcgaaaaca
aacctcacacggagccctctcccatctccgactctgggccacaaagatgaagcgcctgcg
ggtgcaacggaagccgtcgccgctccatcgaccaccgtccccaccccgacacctgaaccc
agtgcttgtggacagctccttctggaggaatcaggcacggtggatctgagggacgtaagg
agccgatgcaccgtatccataggtcgacccctcgatgaggtcatccacattaaggtcaca
tccagctccttgagctgcaggaaaaaggagtacgtggcgttcttcgaccgcctcgctttc
gtgaggaagtgcgcgcaggtggccgggagcgaacttaccaccagaaccaacgtcctgctg
gtgcgacagaatctgttcacgcctgggagcggggtcgcgttcacctacagctcgcagaag
aacgcgaagcggagccaccaccgggattgcgacattcagctattttcccccagcggcgtt
tttgagaatccgttaacatcgaacactaaccacacctgccgagtgctcatcaacgcccct
ccctcggtgaagatcagaatccaagctctgcacataggattagtattcaacgccaccaac
tcccggtctacatacattatgattcgggacatggatgtcttgaagaccaacgtgtttaac
ggccgacagctgttcctgtggcgctcctctggaaatatggccgaggtggaatttcacggc
gactacctgcacaccaaggggaccttcagagctgaatattcctttgtgcatctctga

DBGET integrated database retrieval system