KEGG   Kryptolebias marmoratus (mangrove rivulus): 108238411Help
Entry
108238411         CDS       T05608                                 

Gene name
dock7
Definition
(RefSeq) dedicator of cytokinesis protein 7 isoform X1
  KO
K21852  dedicator of cytokinesis protein 6/7/8
Organism
kmr  Kryptolebias marmoratus (mangrove rivulus)
Brite
KEGG Orthology (KO) [BR:kmr00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:kmr04131]
    108238411 (dock7)
Membrane trafficking [BR:kmr04131]
 Others
  Rho GTPase associated proteins
   Rho guanine nucleotide exchange factors (GEFs)
    108238411 (dock7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHR-2 DOCK-C2 DUF3398 DOCK_N
Motif
Other DBs
NCBI-GeneID: 108238411
NCBI-ProteinID: XP_017275922
Position
Unknown
AA seq 2158 aa AA seqDB search
MAERRAFAQKISRTVAAEVRKQIAGQYGGSPQLFKNLNVGTTSSNTVPLTEAVEPVDFEE
YLITHPPIVESGPLRDLIEFPPDDIEVIYTPRECRTVVQAVPEEGDTDPHVRDCVRSYTE
DWAVVNRKYHKLGTGFNPNTLDKQKERQKGLPKQVFEADEMPDSSSYQDDQDDLKRRSMS
IDDTPRGSWACSIFDLKNSLPDALLPHLLDRAPNEEIDRHNEEQRLSNRHRELFALHPAL
DEEEPIERHCVPEVPKEHFGQRLLVKCLSLKFEIEIEPIFASLALYDVKEKKKISENFFF
DLNSEQMKAMLRPHIQTAAISTLARSAIFSITYPSQDIFLVIKLEKVLQQGDIGECAEPY
MVFKESDAAKNKEKLEKLRGQSEQFCQRLGRYRMPFAWTAIHLMNIVNSAGSLERDTELE
MSLSERKGSWSERRNSSIMGRRSLERTTSGDEACSLTGFRPATLTITNFFKQEGDRLSDE
DLYKFLADMRRPSSVLRRLRPITAQLKLDISPAPENPHYCLTPDLLQVKPYPDSRVRPTR
EILEFPARDVYVPNTTYRNLLYVNPQSLNFANRQGSARNITVKVQFMNGEDPNNAMQVIF
GKSSCADFYKEAYTAVVYHNRSPDFHDEIKIKLPASLSDHHHILFTFYHVSCQQKQNTPL
ETPVGYTWIPMLQNGRLRTGHFCLPVSLEKPPQSYSVLSPDVPLPGMKWVDNHRGVFNVE
LVAVSTIHTQDQYLDKFFALVHALDEHVFPVRIGDMRIMENNLEAELKASIAALTSAQLE
PVVRFLHLLLDKLVLLVVRPPVIAGQIVNLGQASFEVMASVVNRLHKYLDTSQDMHGRNS
LLSSYIHYIFRLPSTDPNSPSPDPNSSLTGPGGLGGSVHYATMARSAVRPASLNLSRSRS
LSNSNPDISGTPTSPDDEVRSIIGSKGLDRSNSWVHTMGCSAPWGSSPGSAPETLQAMER
CGNRMSSHTESASFLQTLTGRLPTKKLFHEELALQWVVSSGSVREGALQQAWFFFELMVK
SIIHHLYFTDRLESPRKNRFPERFMDDITALVSTIAGDIVSRVQKDLELVERLNTSLAFF
LNDLLSVMDRGFVFMLIRTYWKQVSTKLYALQNPTMESLRLDFLRIVCSHEHYVTLNLPC
SLLTPPASPSPSVSSATSQSSGFSTHVQDQKIANMFELSVPFREQHYLAGLVLSELSVIL
DPDNEGMFGLHKKVVSVVHNLLSSHDSDPRYADPEVKARVAMLYLPLIGIVMETLPQLHD
FTESHNQWGRPGGPQGAAVGSGGEEAEGEGNSMISQTVAMAIAGTSTASPMSRPSSFLLN
SQASRQHGSFSAESSRSLLICLLWVLKNADELVLQKWFTDLSVSQLNRLLDLLYLCVSCF
EYKAHVVFTMQGKKAFERMNSLTFKKSKDMKAKLEEAILGSIGARQEMVRRSRGQLERSP
SGSAFGSQENLRWRKDMTHWRQNTERMDKSHRSVRTRAELEHEALIDGNLATEANLIILD
TLEIIVQTVSVTESKESILGGVLKVLLHSMACNQSALYLQHCFATQRALVSKFPELLFEE
ETEQCADLCLRLLRSCSSSISTIRSHASASLYLLMRQNFEIGNNFARVKMQVTMSLSSLV
GTSQNFNEEFLRRSLKTILTYAEEDLELRETTFPDQVQDLVFNLHMILSDTVKMKEHQED
PEMLVDLMYRIAKGYQTSPDLRLTWLQNMAGKHSERNNHAEAAQCLVHSAALVAEYLSML
EDRKYLPVGCVTFQNISSNVLEESAVSDDVVSPDEEGICSGKYFTEIGLVGLLEQAAASF
SMAGMYEAVNEVYKVLIPIHEANRDAKKLATIHGKLQEAFSKIVHQSTGWENGKRMFGTY
FRVGFYGSKFGDLEEQEFVYKEPAITKLAEISHRLESFYGERFGEEQVEVIKDSNPVDKC
KLDPNKAFIQITYVEPYFDTYEMKDRITYFDKNYNLRRFVYCTPFTLDGRAHGDLHEQFK
RKTILTTSHAFPYIKTRINIIHKEEIISTPIEVAIEDMQKKTQELAFATHQDPADAKMLQ
MVLQGSVGTTVNQGPLEVAQVFLSEIPSDPKLYRHHNKLRLCFKDFTKRCEDALRKNKSL
IGPDQKEYQRELERNYHRLKEALQPLINRKIPQLYKPVLQVNSHRDSFSRMSLRKLEI
NT seq 6477 nt NT seq  +upstreamnt  +downstreamnt
atggctgaacgccgcgcattcgcccagaagatcagcaggactgtggcagcagaggttagg
aagcagatagctggtcagtatgggggttcgccacagctcttcaaaaacctcaacgttggg
accacatcaagcaacacggttcccctcacagaggcggtggagcccgtggactttgaggag
tatctcatcacgcaccctcccatcgttgagtcgggtccgctgagagatctgattgagttt
ccccctgatgacatcgaggtcatctacacaccccgggagtgtcgcactgtggtacaagct
gttccagaggaaggagacactgatcctcatgtcagagattgtgtcagatcctacacagaa
gactgggccgttgtcaacagaaagtatcataagcttggcacgggctttaaccccaacact
ctggataaacaaaaggagcgtcagaaaggcctgccgaaacaagtgtttgaagctgatgaa
atgccagatagcagcagctaccaggatgaccaggatgatctgaagcggcggtcaatgtct
atagatgacactccacgaggcagctgggcctgcagcatctttgacttgaagaattccctc
cctgatgccctcctccctcacctcctcgaccgtgcccccaacgaggagattgatcggcac
aatgaagaacagcgcttgtctaaccgccatcgtgagctctttgctctccaccctgccctc
gatgaggaggagcccattgagcgccactgtgtgcctgaagtacctaaagagcactttggc
cagaggctactcgtcaagtgcttgtccttgaagtttgagatcgaaattgaacccatattt
gctagtttggccttatacgatgtcaaggaaaagaaaaagatatcagaaaatttcttcttt
gacctaaactctgagcagatgaaagcaatgttgcgtccgcacattcagacagcagccatt
tccacgctggcacgctctgccattttctccatcacctacccctcccaggatatcttcctg
gtcatcaagctagaaaaggtactgcagcaaggtgatataggagaatgtgcagagccgtat
atggtcttcaaagagtctgatgctgccaagaataaggagaagctggagaagcttcgaggt
caatcagagcagttctgtcagcgtctgggccgctatcgaatgccttttgcgtggacggcc
atccacctgatgaacatcgtaaacagcgctggcagtctggagagagacacagagctggag
atgagcctctcagaaagaaaaggctcatggtcagaacgcaggaactcgagcatcatggga
cggcgttccctggagaggaccaccagtggagatgaagcgtgtagtctcacaggtttcagg
ccagcaacacttactatcaccaacttcttcaaacaggagggggatcggctcagcgacgaa
gacttgtataagtttctcgctgatatgagaaggccttcttcagtgctgaggagactcagg
cccatcacagcccagttaaagttggacatttctcctgctccggagaacccccattattgc
ctgacccctgacctcctgcaggtgaaaccttatccagacagcagagtgcgccccaccaga
gagatcctggagtttcctgccagggatgtttatgtgccaaacaccacctacaggaatctg
ctgtacgtgaacccccagagtcttaactttgccaaccgtcaaggttctgctcgcaacatc
acagtcaaagtgcaatttatgaatggagaggatccaaacaacgcaatgcaggttatattt
gggaagtcaagttgtgcagatttctataaagaggcctacactgcagtggtgtatcataac
agatcccctgactttcacgatgagatcaagatcaagctgcctgcctctctgtcagaccac
caccacattctcttcaccttttaccatgtcagctgccagcagaagcagaacacgccactg
gagacacctgtgggatacacgtggatcccaatgttgcagaatggacgcctgcgaacggga
cacttctgtctgcccgtgtctcttgagaagccgcctcagtcgtactctgttctctcccca
gatgttcctctgccgggaatgaagtgggtggacaaccatcgaggtgttttcaacgtggaa
ctggtggctgtttcaaccatccacacgcaggaccagtacttggataagttctttgccctg
gtacatgctctggatgagcatgtgtttccggtcaggataggagacatgcgcatcatggag
aacaatctggaggcggagcttaaagccagcattgctgcactcacctcagcccagcttgag
ccggtggttcgattccttcatcttctgctcgacaagttggtcctgcttgtagttcggccg
ccggtcatagctggacagatcgtgaatctaggtcaagcatcctttgaggtcatggcgtcg
gttgtgaaccggcttcataaatacctggacaccagccaagatatgcatggccgcaacagc
ctgctgtcgtcttacatccactacatcttccgcttgcctagcacggaccccaactcacca
tcgccagaccccaactcatccctaacaggtcccggagggttgggaggttcagttcactat
gccaccatggctcgctctgcagttcgaccagccagcctcaacctcagccgctcccgtagc
cttagcaacagtaacccagacatctctggtacgcccacatctcctgacgatgaggttcgc
tccataattggcagcaagggcttagaccgctccaactcgtgggtgcacaccatgggctgt
agtgccccctggggatccagccctgggtccgctccagaaaccctgcaggccatggagcgc
tgtggcaatcgcatgtcttcgcacactgagagcgccagtttcttgcaaactttaactgga
cggttacccactaaaaagctcttccacgaggagctggccctccagtgggtggtgagcagt
ggaagcgtccgggaaggagcactgcaacaggcctggttcttttttgaactcatggtgaag
agcattatccaccacctttatttcaccgaccgcttagagtcacccaggaagaaccgtttt
cccgaacgcttcatggatgacatcacagctctggtcagcaccattgccggggacattgtg
tctcgcgtccagaaggatctggagttggtggagaggctgaacaccagcctggccttcttt
ctcaatgacttgctgtcagtcatggaccgaggctttgtcttcatgttaatcaggacatat
tggaaacaggtctccacaaagctttacgctctgcagaacccaactatggagtctttaagg
cttgatttcttaagaattgtttgcagtcacgaacactacgtcaccttaaatctgccctgc
agcctgctcactccgcctgcgtcgccttccccatctgtgtcctcagccacctcacagagc
tctgggttctccactcatgttcaggaccaaaagatagccaacatgtttgagctgtctgtc
ccgttcagagagcaacattatctggctggactcgtgttatctgagctgtctgtaatactg
gacccagataacgaggggatgttcggtctgcataagaaagtggtgagtgtcgtccacaac
ctcctgtccagccatgactctgaccctcggtacgccgatcctgaggtcaaggctcgagtc
gccatgctctacctgcctctcatcggcattgtcatggagacactgccgcagctccatgac
tttacagagtctcataaccagtggggtcggcccggcggtccacagggcgcagcggtgggc
agcggtggagaggaagcagaaggggaagggaacagcatgatcagtcagactgttgccatg
gcgatagcaggcacctccactgcatctccaatgtcccgaccaagtagcttcctgctcaac
tcgcaggcgagtcgtcagcacgggagcttctcggccgagtcgagtcgcagcctgctgatc
tgtctgctgtgggttctgaagaacgctgatgagctggtgctacagaagtggttcacagac
ttgtctgtgtcccagctcaaccgcctgctggatctcctgtacctctgtgtctcctgcttt
gagtacaaggcccatgttgtgttcaccatgcagggaaaaaaggcatttgagcgcatgaac
agcctgacctttaagaaatccaaagatatgaaggccaagctggaggaggccatcctgggc
agcatcggggccagacaggaaatggtgcggcgcagtcggggacagctagagcggagccca
tctggcagtgcctttggcagtcaggaaaacctcagatggaggaaggacatgacccactgg
agacaaaacactgaaaggatggacaagagtcacagatcagtcagaacgagagcagagctg
gaacatgaagccctcattgatggaaaccttgccacggaggccaacctaattattcttgat
acgctggagatcattgttcagacagtgtcagtgacagaatccaaggagagtatcctgggt
ggggtgttgaaggtcctgcttcacagcatggcctgcaaccagagcgccctctacctgcag
cactgctttgccactcagagagccctggtttctaagtttcctgaactgctgtttgaggaa
gaaacggagcagtgtgctgatctgtgcctgcgacttctgaggagctgcagcagtagcata
agtaccatcaggtcccacgccagtgcctccctctacctcctcatgaggcaaaactttgag
atcggcaataactttgcaagagtgaagatgcaggtgaccatgtctctgtcctcgctggtg
ggaacgtcccaaaactttaatgaggagttcctccggcggtctctgaagaccatccttacc
tacgcggaggaggacctcgaactgcgggagaccacctttccagaccaggtccaggacctt
gtgtttaatctgcacatgatcctgtctgacacagtgaagatgaaagaacatcaagaagat
cctgagatgttggtagatctcatgtacaggattgcaaagggataccagacatctccagac
ctgcgccttacgtggctccagaacatggctggaaagcactcagagaggaataaccacgcc
gaggctgctcagtgtttagtgcacagcgccgccctggtggcagaatacctgagcatgctt
gaggaccgcaagtacctccctgtaggctgcgtcaccttccagaacatctcttcaaatgtg
ctggaggaatctgctgtctctgacgatgtggtgtcacccgacgaggagggcatctgctcg
gggaaatacttcactgaaatcggtcttgtgggtctcctggagcaggcagctgcctccttc
tccatggctggcatgtatgaggcagtgaatgaagtctacaaggtgctgatcccaatccac
gaagccaacagagacgcaaagaagctcgccaccatccatggtaaactacaagaagccttt
agcaaaatcgttcatcagagtactggctgggagaatgggaagaggatgtttgggacgtac
ttcagagtcggtttttacggttcaaagttcggcgacttagaggagcaggagtttgtttac
aaagaacctgccatcaccaagctggctgaaatctctcacaggctggagagcttctatggg
gagcgatttggagaggagcaggtcgaagttattaaggactccaatcctgtagataagtgc
aagcttgaccccaataaggcattcattcagatcacatacgtggagccgtactttgacact
tacgagatgaaagaccgcatcacctacttcgacaagaactacaacttgaggcgttttgtg
tactgcactcctttcaccctggacgggagggcccacggagacctgcacgagcagttcaaa
cgcaagaccatcctcaccacgtcacacgccttcccttacatcaagacgaggatcaacatc
atccacaaagaggagattatttccacacccatagaggtagcgatcgaggacatgcagaag
aagactcaagagttggcctttgccacccatcaggacccggctgatgccaaaatgctgcag
atggtcctgcagggatcagtgggcacgaccgtgaaccaggggcctttggaggtggctcag
gtgttcctgtcagagatccccagtgaccccaaactgtacagacaccacaacaagctccgg
ctgtgcttcaaagacttcacaaagaggtgtgaagacgccctgcggaagaacaagagcctg
attggccccgaccagaaggagtaccagagagagctggagaggaactaccacagactgaag
gaggcgctacagcccctcatcaacaggaagatcccgcagctttacaagcctgtcctgcag
gtgaactcacacagagattcgttcagcaggatgagtcttcgaaagcttgagatttga

DBGET integrated database retrieval system