KEGG   Kryptolebias marmoratus (mangrove rivulus): 108240039Help
Entry
108240039         CDS       T05608                                 

Definition
(RefSeq) mitogen-activated protein kinase kinase kinase kinase 4-like isoform X1
  KO
K04407  mitogen-activated protein kinase kinase kinase kinase 4 [EC:2.7.11.1]
Organism
kmr  Kryptolebias marmoratus (mangrove rivulus)
Pathway
kmr04010  MAPK signaling pathway
Brite
KEGG Orthology (KO) [BR:kmr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    108240039
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:kmr01001]
    108240039
Enzymes [BR:kmr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     108240039
Protein kinases [BR:kmr01001]
 Serine/threonine kinases: STE group
  STE20 family
   108240039
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase CNH Pkinase_Tyr Pkinase_fungal Kinase-like Kdo FTA2
Motif
Other DBs
NCBI-GeneID: 108240039
NCBI-ProteinID: XP_017278626
UniProt: A0A3Q3F675
Position
Unknown
AA seq 1277 aa AA seqDB search
MSRENTTRSLDSIDLAALRDPAGIFELVEVVGNGTYGQVYKGRHVKTGQLAAIKVMEVTE
EEEEEIKLEINMLRSYSHHRNIATYYGAFIKKGPAGQDHQLWLVMEYCGAGSVTDLVKKT
KGSCLKEDWIAYICREVLRGLSHLHSHHVIHRDIKGQNVLLTENAEVKLVDFGVSAQLDK
TIGRRNTFIGTPYWMAPEVIACDENPEATYDYRSDLWSLGITALEMAEGAPPLCDMHPMR
ALFLIPRNPPPKLKSKKWSKRFLSFVDSCLIKNHLHRPATDTLLKHAFIRDLNNERQVRI
MLKDHLDRTRKKREKEGPEYEYSGSDDDDDEVPEEEGEPSSIVNVPGEWTLRREFLRLQT
EDREGGREGDRGGGGGGRGGDQQKQSLQQLRQQLSEQERYKQQVLIDRQRRIQQQLEQRQ
KLENQQKQQMADCPFQWAELQEVFVGEESDLHDNRILLDERNRKRDRRQDPAGRQQSADV
SVRPVDSAEEQRSAAPIQLLQHKAQQSQHSQLQLQAKPQPVAQHQQPPAGRRSHRTLPKD
QTQLLSLQHDHRHREKERLRQREPPVAAVQKLTAFSGHKAAPSAPAAAPAAAAPGRPTNP
QRTAMELQESQLTRVLLAAGLPSQMHSRLGSGSSSSPCTPAMPRAQFSQNANLLSSRDSP
HSSSLSDMALSPLSPFSPLSPTDDVFWDSAETPPKVPERTTSKFYCRELVKGHKRTASSG
SPVSLTEKSGWFVSQGGSSSSSNHPGYFNLESPLLQHRLQHQKKPDSTSGHTQAVKLALA
RFNKATEYSSSSDEVGSSDEEERNRSSLSNGKGKHFRGLPNGIVLQPHHNLNQMSRMNSE
DAYLLPDLLQKTSSSSSTPTALSQQRTRELSYSLSPTAPGSPMLQDLHALRSPSGKSSSS
TSSLSTIDPRLIPISSPPLSPTSSKGDPLTRENHRKGSVVNVNPTNIRPHSDTPEIRKYK
KKFNAEVLCAGLWGVNLLVGTENGLWLLDRSGQGKVYSLISRRRFQQMDVLEGLNVLITI
SGKKNKLRLYYLSWLRNKILHNDPEVEKRQGWTSVGDLEGCVHYKVVRYEKIKFLVIALK
NAVEVYAWAPKPYHKFMAFKFFRSLPQKPLSVDLTVEEGQRLKVIYSSVSGFHAIDVDSG
TPYDLYLPTHIQGSIHPHAIIILPNKAGTEVLVCYEDEGVYIDTYGRLTKDTVLQWGEMP
TSVAYLQSNQVMGWGEKAIELRSANTGNLEGVFMHKKAQKLKFLCERNDKVFFASVQSGG
SSQIYFMTLGQNLLFSW
NT seq 3834 nt NT seq  +upstreamnt  +downstreamnt
atgtcgagagaaaacaccacccggagtttggacagcatagacctcgctgctctaagagat
ccagcaggcatctttgagctggtcgaggtggtcgggaatggaacctacggtcaggtgtac
aagggtcgtcatgtcaagaccggtcagctggcagctatcaaagtcatggaggttacggag
gaagaagaggaggagatcaagctggagatcaacatgctgagaagttattcccaccatcga
aacattgctacttattatggtgcctttattaagaaaggccctgctggacaggaccaccaa
ctctggttagtgatggagtactgtggagctggttctgtgacagacttggtgaagaagact
aaaggaagctgtttgaaagaggactggattgcctacatctgcagagaggtgctcaggggt
ctttcccatcttcactcccaccatgtgattcacagagacattaagggacaaaacgtttta
ctcacagagaacgctgaggtcaaactggttgactttggagtctcggcacagctggacaaa
acgataggtcgaagaaacactttcatcggtactccttattggatggctccagaggtcatc
gcctgtgacgagaaccctgaagccacatatgactacaggagcgacctttggtctttaggc
atcactgctttagaaatggctgaaggagctccgcctctctgtgacatgcatccaatgaga
gctctgtttttgattcctcgaaaccctccacctaagcttaagtcgaagaaatggtcgaaa
cgtttcttgtcattcgttgacagctgtctgatcaaaaaccacctgcaccggcccgccaca
gacactctgctgaaacacgccttcatcagagacctgaataacgagagacaggtccgcatc
atgctcaaagaccacctggaccgaaccaggaagaagcgagagaaagagggtccagagtat
gagtacagtggcagtgatgatgacgatgatgaggtcccagaggaggaaggtgaacccagc
tccatagtgaacgttcccggtgaatggacgttaagacgggagttccttcgtttgcagaca
gaagatcgcgaaggaggcagagagggagatcgaggaggaggtggaggaggaagaggaggg
gatcaacaaaaacagtcgttacagcagctcaggcagcagttgtctgagcaggaacgatac
aagcagcaggttctgattgacagacagagaaggatccagcagcaactggagcaacggcaa
aagttagagaaccagcagaagcagcagatggcagactgtccctttcagtgggcggagctt
caggaagtgtttgtaggggaggagtccgatctccatgacaacagaatcctactggatgag
agaaaccggaagcgtgacaggagacaggacccggctggcagacagcagagtgccgatgta
tcagtaaggcctgtggactccgcagaggagcagagatctgcggctcccatccagctgctt
cagcacaaggcccagcaatcccagcattcccagcttcagctgcaggctaagcctcagccc
gttgcccagcatcagcagcccccagcaggcaggaggtcccaccgcaccctgcccaaagat
cagacccagctcctgtcactgcagcacgaccacagacacagggagaaggagaggctcagg
cagagggaaccgcctgtcgcagccgtccagaagctaactgcttttagtgggcacaaagct
gctccttctgctcctgccgctgctcctgccgccgccgcgcccggccgccctacaaacccc
cagcgcacagcgatggagcttcaggagtcccagttaaccagggtgcttctggctgctggt
ctgcccagccagatgcactcgaggctgggctctgggagcagctccagtccttgtactcca
gccatgccgagagctcagttcagccagaatgctaatcttctctccagccgagactcccct
cacagcagctcgctgtcagatatggccctctcccccttgtccccattttcccctctgtct
ccaactgacgatgtcttctgggactcggctgagaccccccctaaagtcccagaacgcaca
acttctaaattttactgtagagagctggtgaaaggacacaagaggacagcttcgagcggc
agtccggtgtctctgacagaaaagagtggatggtttgtgtctcaaggaggctcctcttca
agcagcaaccacccaggctacttcaaccttgaaagtcctctcctgcagcaccgtctacag
caccagaagaaaccagacagcacgagtggacacacacaagcggtaaaacttgctctggct
cgcttcaacaaggccacagaatactcctcttcgagtgacgaggttggcagcagcgacgag
gaagaaagaaacaggtctagtctgtccaatggaaaggggaaacatttcagaggactgcct
aatggcatcgtcttgcagccccatcacaaccttaaccagatgtcccggatgaattcagag
gatgcctatctgcttccagacctcctgcagaaaacctcttcctccagttccactcctact
gcgctgagccagcagcgcacacgtgaactcagctactcgctgtcccccacagctcctggg
tcccccatgctgcaggatttacatgctttaagaagtccttctggcaaaagcagctcttcc
acttcctctctgtccaccatcgacccaagactgatccccatatcatcaccaccactgagt
cccacgagcagtaagggtgatccactgacgagagaaaatcacaggaagggctccgtggta
aacgtgaacccaaccaacattcggccacacagcgacacgccagaaattcgaaagtacaag
aaaaaattcaacgccgaggttctgtgtgctggcctttggggtgtgaacctgttggtgggg
acagaaaacggcctgtggctgttggatcgaagcggacaagggaaagtctactcactcatc
agcagacgaaggtttcagcagatggacgtgctggagggactcaacgtcctgattacaata
tcaggtaaaaagaacaagctgcgtctgtactacctgtcctggttaagaaataagattctc
cataatgacccagaagtggagaagagacagggctggacctcagtgggggacttggagggc
tgtgtgcactataaagtggtgcgatacgagaagattaaattcttagtgatcgctttaaag
aatgctgtggaggtgtacgcctgggccccaaaaccctaccacaaattcatggccttcaag
ttcttcaggtccctgcctcagaaaccactgtctgttgacctgacagtggaggaaggacaa
aggttaaaggtcatctacagctccgtgtctggtttccacgccattgacgtcgactctgga
acaccatatgatctctacctgcctacacacatccagggctccatccatcctcatgccatt
atcattttgccaaacaaagctggaacagaagttttggtttgctacgaagacgagggcgtc
tacatcgacacctacggccgcctcaccaaagacacggtgttacagtggggcgagatgcct
acgtctgtcgcctaccttcagtccaaccaggtgatgggctggggagagaaggccatcgag
ctgaggtcagccaacaccggcaacctggagggagttttcatgcacaaaaaggctcagaag
ctcaagttcctgtgtgagaggaacgacaaggtgttctttgcgtcggtgcagtccggaggc
agcagtcagatttacttcatgacgctcggacagaacctgctgttcagctggtag

DBGET integrated database retrieval system