KEGG   Kryptolebias marmoratus (mangrove rivulus): 108240489
Entry
108240489         CDS       T05608                                 

Gene name
mecom
Definition
(RefSeq) MDS1 and EVI1 complex locus protein isoform X1
  KO
K04462  ecotropic virus integration site 1 protein
Organism
kmr  Kryptolebias marmoratus (mangrove rivulus)
Pathway
kmr04010  MAPK signaling pathway
Brite
KEGG Orthology (KO) [BR:kmr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    108240489 (mecom)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:kmr03000]
    108240489 (mecom)
Transcription factors [BR:kmr03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 developmental/cell cycle regulators, Krueppel-like
    108240489 (mecom)
SSDB
Motif
Pfam: zf-C2H2 zf-C2H2_4 zf-H2C2_2 zf-C2H2_jaz zf-C2H2_6 zf-H2C2_5 zf-C2H2_8 zf-BED NtCtMGAM_N
Other DBs
NCBI-GeneID: 108240489
NCBI-ProteinID: XP_017279490
Position
Unknown
AA seq 1265 aa
MRSKGRARKLATSDGDDDFALYPANILDDICGSNGDPTLTSTLAEDPLSDDELSPQSVQQ
PSVFLTQTDVTIPLDFELRESAVPGAGLGIWSRRKVNTGERFGPYEGEHSPCLQDPTQGW
EILDGSGHVKFCVDASKPDAGSWLKHIQFAPAAFQHNLTACQIDDQIFYKVTREIFPGEE
LLLFMKAEEYSCDTMAPDIHEERQYRCEDCDQNFESRSQLLDHQKQPCGMPPSSFLNPGG
DSDLKAQEPEDLRPLHMSHGLHECKECDQVFPDVQSLEAHILSHSEEREYKCDQCPKAFN
WKSNLIRHQMSHDSGKHYECENCSKQVFTDPSNLQRHIRSQHVGARAHACSDCGKTFATS
SGLKQHKHIHSSVKPFMCKSLRPYLCEVCHKSYTQFSNLCRHKRMHADCRTQIKCKDCGQ
MFSTTSSLNKHRRFCEGKNHFTAGGLFAQGMPLPGTPGLDKSALTIGHTSAGLADYFGAS
RHHSGLTFPAAPAFPFSFPGLFPSGLYHRPPLIPATTSPVRQPAHAPVAGPGSELCKSPL
LPLSPGAMESQELLKALRKDGGSPGNQIPDSELHNQGSSSTTKQRNKQSDQSESSDLDDV
STPSGSDLESTTGSELESDMDSERERGAARENGKGPKRKGREGSSQSPNFIGSSAAKDFP
GPSLIQSSLDEHTAVTGAVNDSIKAIASIAEKYFGSTGLASLQDKKVGSLPYPSMFSLPF
FPAFSPPVYPFPDRDLRPTGLKGEPQSPGDDSKKTQSKSSSESPFDLTIKRKEEKLALFA
SSKPDVSHATGQDQPLDLSLGSRGRGRIPNQEEAKKNLSYEEEKRVMEIPKTDSSLQHAR
PTPFFMDPIYSRVEKRRMSDPFETLKDKYMRPTPGFLFHPQFRLPDQRTWMTAIENMAEK
LETFGSLKPESGELLRSVPSMFDFRAPPSALPETLLRKGKERYTCRYCGKIFPRSANLTR
HLRTHTGEQPYRCKYCDRSFSISSNLQRHIRNIHNKEKPFKCHLCDRCFGQQTNLDRHLK
KHENGNLSGTAMSSPQSELDSGSAILDDKEDSYFNEIRNFISNAGQNHTSPDHSEEGLNG
GSLEEVKPLMASHGSQDLEDEEVEDLDADDEEVEESSKGPEKREPKVHTSSLSDDIIQDE
MDFSEPNDLNLSCKTSPRRYKDEEEQSSYSALDHIHRFSDLRKLEESELSDGDGDEDDRA
FGSPSLTEAVKQPLFRKSKSQAYAMMLSLAEKDSLHSATHTPATMWHSLARAAAESSAIQ
SLSHV
NT seq 3798 nt   +upstreamnt  +downstreamnt
atgaggtccaaaggcagggcacggaaactggccacgagtgatggtgatgatgactttgcc
ctctatccagccaacatcttagatgacatttgtggctctaatggcgatcccacgctcact
tcaaccctggcagaggacccgctatctgatgatgagttgtcacctcagtcagtccagcaa
ccaagcgtctttttaacccaaactgacgtgaccattcctctggactttgaactgagagag
tcagcagttccaggtgctggtctcggcatttggagccgcaggaaggtgaatactggggaa
cgctttggaccttatgaaggagaacacagcccttgcctccaagatcccactcaaggctgg
gagattttggacgggtcaggccatgtaaagttctgcgtggatgccagcaaaccagacgca
ggcagctggctgaagcacatccagtttgcccccgcggcctttcagcataacctgacagcg
tgccagatagatgatcagattttctacaaagtcaccagagagatttttcccggtgaggag
ctgctacttttcatgaaggcagaagagtattcatgcgacacaatggctcccgatattcac
gaggagaggcagtaccgctgtgaagattgtgaccagaactttgagtcccgcagccagctg
ctggaccaccagaagcagccatgtgggatgccgccctcttcgtttcttaatccaggagga
gacagtgacctgaaagctcaagaacctgaagatttgcggccccttcatatgtctcatggc
ctgcatgagtgtaaggagtgtgaccaggtcttccctgatgtccagagcctggaggcccac
attctgtcacactccgaagagagggaatataagtgtgaccagtgccccaaggccttcaac
tggaaatcaaacttgatccgacatcagatgtcgcacgacagtggcaagcactacgaatgt
gaaaactgctcaaagcaggtgttcacagaccccagtaacctacagaggcacattcgctcg
cagcacgtcggggctcgtgcccatgcctgctccgactgcggcaagacgtttgcaacgtct
tcgggtctcaagcagcataagcacatccacagcagtgtcaagcccttcatgtgtaagtca
ctaagaccctacctatgtgaggtatgccacaagtcctacacccagttctctaacctttgc
cggcacaaacgcatgcatgccgactgccgcacacagatcaagtgcaaagactgtgggcaa
atgttcagcaccacctcatccctcaacaagcatcggcggttctgtgaaggaaaaaaccat
ttcacagcagggggactgtttgcccagggtatgccactccctggcacccctggcttggac
aaatcagccctcacaattgggcacaccagtgctgggctggctgattactttggggctagc
cgccaccacagtgggcttaccttccctgcagccccagcatttcctttcagcttccctggc
ctgtttccttcgggactctatcaccgaccaccactcattcctgctaccacctctcctgtc
agacagccagctcatgcacctgttgcaggacctggttcggagctgtgtaaaagtcctttg
cttcctttaagccctggcgcaatggagtctcaagagctgctgaaagctctccgtaaagat
ggtggttcacctggaaaccagataccagactcggagctccataatcagggttcatcttca
accacaaagcagcggaacaagcagagtgaccagtctgaaagcagcgacctggatgacgtc
agcacgccaagcggaagcgatctggagagtacaacaggctctgagcttgaaagtgacatg
gacagtgaaagggaaaggggagcagctcgagaaaatggcaaaggtcctaagagaaagggc
cgcgagggaagctcccaaagccccaacttcataggtagcagtgctgccaaagactttcca
ggcccttcccttatccagtcttcactagatgagcatacagccgtaacaggggctgtgaat
gactctataaaggccatcgcctctattgctgaaaaatattttggctcaactgggctagct
agcttgcaagacaagaaggttgggtctctgccctacccctccatgttttcactgcctttc
ttcccagctttctctccaccagtttaccccttcccagacagggacctcagaccaacaggc
ctgaaaggtgagccacaatcaccaggagatgatagcaagaagacccaaagcaagtcttca
tctgagtcaccatttgacctcactatcaaaagaaaggaggaaaagttagccctttttgct
tcctctaaaccagatgtctcacatgctactggtcaagatcaaccgttagatctgagcctt
gggtctaggggccgtggacgtattccaaatcaggaggaggccaaaaagaatctaagctac
gaagaggagaaaagagtgatggagattccaaaaacagattcctctttacagcatgccagg
ccaactccatttttcatggaccccatctacagcagggttgagaagaggagaatgagcgat
ccgtttgagacactgaaagacaaatacatgcggccaactccaggcttcctcttccatccg
cagtttcgtttgccagatcagagaacttggatgacggctattgagaacatggcagagaaa
ctggagacgtttggctccctgaagccagaatccggtgaactgctgcgctccgttccgtcc
atgtttgacttccgagccccgccgtctgcacttccagagacgctgctacgcaagggcaag
gagcgctacacatgcagatactgtggaaaaatatttccccgctctgccaacctgactcgc
cacctcaggactcatacaggagagcaaccatacaggtgtaaatactgtgaccgctccttc
agcatctcctccaacctgcagcgtcatattcgcaacatccacaacaaggagaagcccttc
aagtgccacctgtgtgaccgctgcttcggccagcagaccaacctcgaccgtcacctgaag
aagcacgagaacggcaacttgtcaggcactgcaatgtcatccccacagtctgaactggac
agtggtagcgccatattggatgataaagaggattcttactttaatgaaataagaaatttc
atcagtaacgcaggacagaaccacacatcaccagatcactctgaggaagggctgaatgga
ggttcattggaagaagtgaaaccactgatggccagccacggatcgcaggatctggaagat
gaggaagtggaggacctagacgctgatgacgaagaagtggaggaatctagcaaaggtcct
gagaaaagggaacccaaggtgcacacaagcagccttagtgatgacatcatacaagacgaa
atggacttcagtgagccaaatgacttaaacctgagctgtaaaacatcgccaaggaggtat
aaggacgaggaggagcagagcagctactcagccttggatcacattcatcgtttttctgac
ctgcgcaagctggaggagagtgagctgagtgacggagatggagatgaggacgacagagcg
tttggatccccttctcttacggaggcagtcaaacagccactcttcagaaaatccaagtct
caggcgtatgccatgatgctgtccctggctgaaaaggactctcttcactcagccacccac
acgccggcaaccatgtggcacagtctggcgcgggctgccgctgaatccagcgccatccaa
tccctcagccacgtatga

DBGET integrated database retrieval system