KEGG   Kryptolebias marmoratus (mangrove rivulus): 108240568Help
Entry
108240568         CDS       T05608                                 

Definition
(RefSeq) cis-aconitate decarboxylase-like
  KO
K17724  aconitate decarboxylase [EC:4.1.1.6]
Organism
kmr  Kryptolebias marmoratus (mangrove rivulus)
Pathway
kmr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kmr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00660 C5-Branched dibasic acid metabolism
    108240568
Enzymes [BR:kmr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.6  cis-aconitate decarboxylase
     108240568
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MmgE_PrpD
Motif
Other DBs
NCBI-GeneID: 108240568
NCBI-ProteinID: XP_017279617
Position
Unknown
AA seq 497 aa AA seqDB search
MLSVLQKTTRPVQAARGLHKSALDVLKQPAPEDTVTASFGKFISEIKPQYLSPVALYRSK
RMVLDSVGVGLIGSTTDVFELALQHCQHMHAPDPISSVYGRRGIRLSPTLAAFVNGVATH
SMDFDDTWHPATHPSGAVLPAVLALSDMMPANSKPSGLDFLLAFNVGIEIQGRLMRFSNE
AHNIPKRFHPPTVVGPMGSAAACARLLSLDPSQCSHALAIAASLAGAPMANAATQCKPLH
IGNASRLGLEAALLASRGLEASPLVLDAVAGVAGFNAFYEDYVPQPLKSPSDNDNGHVFL
LEEQDMGFKRFPAHLGMHWVADAAASVHKVLVGVDPGKVSPDQVQDILLRVPLSKYINRP
FPESEHEARHSFQFNACSALLDGEVAVQSFSPAAMSRPELHALLSRVRLEHPQDNPANFN
RMYGEVQVTLVGGDILKGRCDTFYGHWRNPLTNESLRKKFRNNAGVVLPSEKVERLIEAV
EELDRLDDCGALLSQLE
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atgctctccgtgctacagaaaaccaccagaccagtgcaggctgccagaggactgcataaa
tctgcactggatgtcctgaaacaaccggcccctgaggacacagtcacagcaagttttggg
aagttcatcagtgaaataaagcctcagtatttgtctcctgttgcgctctatcgcagtaaa
aggatggtgctggacagcgtcggggtgggcctcattgggagcacaacagatgtgtttgag
ctggcccttcagcactgccagcacatgcacgctcctgatcccatcagctctgtttatgga
cgcagaggcatcaggctctctccaacactggccgcttttgtcaacggggtggcgacccat
tccatggactttgatgatacatggcacccagcaactcacccttcaggagccgtccttcct
gctgtgttggctctcagtgacatgatgccagctaacagtaaaccaagtggcctggatttc
ttactggccttcaacgtcggcatcgagatccagggtcgtctaatgaggttctctaatgaa
gcacacaacatccccaagaggttccacccccccactgtggtgggtcctatgggaagtgca
gcagcctgtgctcgcctcctgtccttggatccctctcagtgcagtcatgccttggctatc
gctgcttctctagctggagcaccgatggcaaatgctgccactcagtgcaaaccccttcat
attggcaatgcctctcgtttggggcttgaagctgctctgctggcctcccgaggcctagag
gccagtcctctggtcttggatgctgttgcaggagtggcgggctttaacgccttttatgaa
gattatgtcccacagcctttaaaatcacccagtgataatgacaatggccatgtgttcctc
ctagaggagcaggacatgggttttaagcgtttccctgcccatctggggatgcactgggtg
gcagatgctgcagcatcggtccataaggttcttgttggcgttgatccaggaaaggtctcc
cctgatcaggtccaggacatcctgctcagagttcctctgtctaaatacatcaacaggcct
tttccagagtcagaacacgaggcacgccactccttccagttcaatgcctgcagcgctctc
ctggacggtgaggtggccgttcagtccttcagcccagctgccatgagccgccctgagctg
cacgccctgctgagccgcgtccgcctggagcatcctcaggacaacccagctaacttcaac
cgcatgtacggcgaggtccaggtgactctagttggaggagacattctaaagggccgctgt
gacaccttctatggtcactggcgcaacccgctgaccaatgagagcctgaggaagaagttc
aggaacaacgcaggcgtggtccttccatcagagaaggttgagcgtctgattgaggcggtg
gaggagctggacaggctggacgactgtggggctcttctctcacagctggaataa

DBGET integrated database retrieval system