KEGG   Kryptolebias marmoratus (mangrove rivulus): 108242079Help
Entry
108242079         CDS       T05608                                 

Gene name
gpx3
Definition
(RefSeq) glutathione peroxidase 3
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
kmr  Kryptolebias marmoratus (mangrove rivulus)
Pathway
kmr00480  Glutathione metabolism
kmr00590  Arachidonic acid metabolism
kmr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kmr00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    108242079 (gpx3)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    108242079 (gpx3)
Enzymes [BR:kmr01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     108242079 (gpx3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GSHPx AhpC-TSA
Motif
Other DBs
NCBI-GeneID: 108242079
NCBI-ProteinID: XP_017282173
Position
Unknown
AA seq 219 aa AA seqDB search
MWTFFPLLLLALPRPCAGAALTQMCDSSADGTIYKYHAKTLNGSHTVNFTDYTGKCVLFV
NVATYUGLTLQYVELNALHEELKHHGFTVLGFPCNQFGKQEPGQKDEILPGLKHVRPGNG
FVPNFLLFEKGDVNGEAEQEVFTFLKNSCPPAGADFGAVNGRLFWEPLKISDIKWNFEKF
LVGPDGKPVMRWHPRVSVSEVRADIRKYLLQLYTQAIFS
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atgtggaccttcttcccgctgctgctgctcgccttaccgcgaccctgtgccggagcagcc
ctcacacagatgtgtgactcatccgccgacggcaccatctacaaataccacgccaagact
ctaaacgggagtcacaccgtgaacttcacggactacactggaaagtgtgtcctctttgtc
aacgttgcaacatactgaggcttgaccctccagtatgtggaactgaatgcactgcacgaa
gagctgaagcaccacggcttcaccgtcctcggctttccctgcaaccagtttggcaaacag
gagccggggcagaaggacgaaatcctgccgggattaaagcacgtccggccaggcaacggc
ttcgttccaaacttcctgctgtttgagaaaggagatgtgaacggagaggccgagcaagag
gtcttcaccttccttaaaaactcctgccctccggcgggggccgacttcggcgccgttaac
ggcaggctgttctgggagcctcttaagatcagcgacatcaagtggaacttcgagaagttc
ctggtgggaccagacgggaagccggtgatgaggtggcacccacgagtcagcgtgtccgaa
gtccgagccgacatccgcaaataccttcttcagctctacacccaggctatctttagctaa

DBGET integrated database retrieval system