KEGG   Kryptolebias marmoratus (mangrove rivulus): 108242605
Entry
108242605         CDS       T05608                                 

Gene name
dck
Definition
(RefSeq) deoxycytidine kinase
  KO
K00893  deoxycitidine kinase [EC:2.7.1.74]
Organism
kmr  Kryptolebias marmoratus (mangrove rivulus)
Pathway
kmr00230  Purine metabolism
kmr00240  Pyrimidine metabolism
kmr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kmr00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    108242605 (dck)
   00240 Pyrimidine metabolism
    108242605 (dck)
Enzymes [BR:kmr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.74  deoxycytidine kinase
     108242605 (dck)
SSDB
Motif
Pfam: dNK AAA_18 AAA_33 Thymidylate_kin AAA_28 AAA_17
Other DBs
NCBI-GeneID: 108242605
NCBI-ProteinID: XP_017283047
UniProt: A0A3Q3GLP8
AA seq 275 aa
MPPVPKRPCPESTDDSMNDSLNSSMDNSMEKRVKRISIEGNIAAGKSTFVRLLEQESSDW
EVVPEPIARWCNVQTTGSDFEELTTSQRSGGNVLQMMYEKPERWAYTFQSYACISRIRAQ
TRSASWKLSKAEDPVQFFERSVYSDRYIFASNLYESECMNETEWSIYQDLHSWLHNQFGQ
HIELDGIIYLRASPEKCLERLHLRGRQEEQEIPLEYLEKLHFKHENWLQHKKMAMEFEYL
RDVPVLTMDVNEDFNKNNIKSSDMIEKVKDFLSSL
NT seq 828 nt   +upstreamnt  +downstreamnt
atgccacctgttccaaagagaccctgccccgaatctacagacgactccatgaacgactcg
ttaaatagctcgatggacaactccatggagaagagagtaaagcgaatttcaatcgaaggg
aacatcgcggcgggtaaatccacctttgtgcgccttttggagcaggagagctcagactgg
gaggtggtaccagaacctatcgccagatggtgcaatgtccaaacaacaggcagcgacttt
gaggagctgaccacgtctcagaggagtggagggaacgtattgcagatgatgtatgagaag
ccagagaggtgggcctacaccttccagagttatgcctgcatcagccggattcgtgcccag
accagatcagccagctggaagctctcaaaggcagaggatccggtgcagttctttgagcga
tccgtctacagtgacaggtacatctttgcttccaacctatatgagagcgagtgcatgaat
gagacggaatggtccatctaccaggacttgcacagctggctccacaaccagtttggccag
cacatcgagctagatggcattatttacctcagagcttcaccagagaaatgtttggagaga
ttacatctgagaggcagacaggaggagcaggagatccctttggagtatctggagaagctc
cactttaagcacgagaactggctgcagcacaagaagatggccatggagtttgagtacctt
cgtgacgtgcctgtgctgaccatggacgtgaacgaagactttaacaaaaataatatcaaa
agttctgacatgattgagaaggtaaaggacttcttgagctcgctgtaa

DBGET integrated database retrieval system