KEGG   Kryptolebias marmoratus (mangrove rivulus): 108242898Help
Entry
108242898         CDS       T05608                                 

Definition
(RefSeq) multiple inositol polyphosphate phosphatase 1-like
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
kmr  Kryptolebias marmoratus (mangrove rivulus)
Pathway
kmr00010  Glycolysis / Gluconeogenesis
kmr00562  Inositol phosphate metabolism
kmr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kmr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    108242898
   00562 Inositol phosphate metabolism
    108242898
Enzymes [BR:kmr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     108242898
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     108242898
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2
Motif
Other DBs
NCBI-GeneID: 108242898
NCBI-ProteinID: XP_017283551
UniProt: A0A3Q3B9H5
Position
Unknown
AA seq 462 aa AA seqDB search
MTTTLWKLILIHVTAAAGVSCCVQSPGDHPNIPAIAKYFCTKGRYEEVNPHLVEDILAVN
TSILQPPSAQCRVIHLTAIVRHGTRYPTAKNVKKMQRFHELVRKEARGLQWWVREIRTRW
KMWYTEDMDGRLARKGVEDLKHLAVRLSKLFPSVISEATLRAALVEFITSSKHRCVNSTL
SFQAGLTELWDIKDVEFDHTVNDALMRFFDQCTKYVRDVGDNPSAMPELDKFQQGPEMNR
VLQKIADRLGVPYALITADMAEAALYLCAYEFAIKTENSPWCRLFDEVDAQVMEYLIDLK
QYWKRGYGYDINSKSSCILFHDVFSRLDKAAETNRLGQQVTEAVTVQVGHAETLLPLLTL
LGFFKDTVPLTASNYASQAQRSFRTSLMLPYAANLVLALYDCGGGDVRLQPLLNEKPVTF
PGLTDGQASMPLYEEVKKHYKDLLLGCDFETECQLFEKPAEV
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atgacgaccactttgtggaaactcattttgatccacgtcacggccgccgcaggcgtctca
tgttgtgtccagagcccgggggaccacccaaacataccggccatcgccaaatacttctgc
accaaagggaggtacgaagaagtcaacccccatctcgtggaggacatcctcgccgtgaac
acgtccatcctgcagcctccgtccgcgcagtgccgcgtcatccacctgacagcgatcgta
cggcacgggaccaggtacccgacggccaagaatgtcaagaagatgcagaggttccacgag
ctggtccggaaggaggcccggggcctgcagtggtgggtgcgcgagatccggacccggtgg
aagatgtggtacaccgaggacatggacggccgcctcgcgcgcaagggcgtggaggacctg
aaacatctggccgtgcggctgtcaaagctgttcccctccgtgatctcggaggcgacgctc
cgggcggcgctcgtggagttcatcaccagctccaagcacagatgcgtcaacagcacgctg
tccttccaagcaggactcacagagctgtgggacattaaagatgtggagtttgaccacacg
gtgaacgatgccctcatgaggttttttgaccagtgcaccaagtatgtgcgggacgtggga
gacaacccgtcggccatgccagagctggacaagttccaacaggggccggagatgaacagg
gtcctgcagaagatcgccgaccgcctgggagtcccgtacgctctcatcacagccgacatg
gccgaagcggcgctctacctgtgcgcgtacgagttcgccataaagacggagaactccccg
tggtgtcggctcttcgacgaggtcgatgcacaggttatggagtacctgattgatctgaag
cagtactggaaacgcggctacgggtacgacataaacagcaaatcgagctgcatcctgttc
cacgacgtgttcagtcgtctggacaaagcagccgagacgaacaggttgggccagcaggtc
accgaggctgtgacggtccaggtgggccacgcagagaccctcctgccccttctcaccctc
ctgggcttcttcaaggacaccgttccgctgacggcgtcaaactacgcctcccaggcgcaa
cgctccttccgcaccagcctcatgttaccgtacgccgccaacttagtcctggcgctgtac
gactgcggaggaggcgacgtcaggctgcagccgctgctcaacgagaagcccgtgaccttc
cccggtttgacggacgggcaggcctccatgccactttatgaagaggtcaaaaagcactac
aaggatctgctccttgggtgtgactttgagaccgaatgccaactgtttgaaaagccagcc
gaagtttag

DBGET integrated database retrieval system