KEGG   Kryptolebias marmoratus (mangrove rivulus): 108243113Help
Entry
108243113         CDS       T05608                                 

Definition
(RefSeq) heat shock cognate 71 kDa protein-like
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
kmr  Kryptolebias marmoratus (mangrove rivulus)
Pathway
kmr03040  Spliceosome
kmr04010  MAPK signaling pathway
kmr04141  Protein processing in endoplasmic reticulum
kmr04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:kmr00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    108243113
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    108243113
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    108243113
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    108243113
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:kmr01009]
    108243113
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:kmr03041]
    108243113
   03009 Ribosome biogenesis [BR:kmr03009]
    108243113
   03110 Chaperones and folding catalysts [BR:kmr03110]
    108243113
   04131 Membrane trafficking [BR:kmr04131]
    108243113
   03051 Proteasome [BR:kmr03051]
    108243113
   03029 Mitochondrial biogenesis [BR:kmr03029]
    108243113
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:kmr04147]
    108243113
Protein phosphatases and associated proteins [BR:kmr01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     108243113
Spliceosome [BR:kmr03041]
 Complex B
  Other components
   Prp19 complex
    108243113
 Complex C
   Prp19-CDC5 complex
    108243113
Ribosome biogenesis [BR:kmr03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    108243113
Chaperones and folding catalysts [BR:kmr03110]
 Heat shock proteins
  HSP70 / DNAK
   108243113
Membrane trafficking [BR:kmr04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    108243113
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    108243113
Proteasome [BR:kmr03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    108243113
Mitochondrial biogenesis [BR:kmr03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    108243113
Exosome [BR:kmr04147]
 Exosomal proteins
  Proteins found in most exosomes
   108243113
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl FGGY_C DDR CRIC_ras_sig
Motif
Other DBs
NCBI-GeneID: 108243113
NCBI-ProteinID: XP_017283842
UniProt: A0A3Q3AR96
Position
Unknown
AA seq 650 aa AA seqDB search
MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA
LNPNNTVFDAKRLIGRRFDDGVVQSDMKHWPFTVINDNTRPKVQVEYKGETKTFYPEEIS
SMVLLKMKEIAEAYLGKTVTNAVVTVPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAA
IAYGLDKKVGSERHVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNH
FISEFKRKYKKDISDNKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGVDFYTSITRA
RFEELNADLFRGTLEPVEKALRDAKMDKAQIHDIVLVGGSTRIPKIQKLLQDFFNGKDLN
KSINPDEAVAYGAAVQAAILCGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTI
PTKQTQTFTTYSDNQPGVLIQVFEGERAMTKDNNLLGKFDLTGIPPAPRGVPQIEVTFDI
DANGIMNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKAEDDVQREKVSAKN
GLESYAFNMKSTVEDDKLKDKISEEDKQKILEKCNEVISWLDRNQYAEKEEFEHQQKELE
KVCNPVMTKLYQSAGGVPGGMPGGMPGGFPGAGGAPGSAGSSGPTIEEVD
NT seq 1953 nt NT seq  +upstreamnt  +downstreamnt
atgtccaaaggaccggctgtgggcatcgacctgggcaccacctactcctgcgtgggggtg
ttccagcacggcaaggtggagatcatcgccaacgaccaggggaaccggaccacgcccagc
tacgtcgccttcaccgacaccgagaggctgatcggagacgcggccaagaaccaggtggcc
ctgaaccccaataacacagtgtttgatgcgaagcgtcttatcgggcgtcgtttcgatgat
ggcgtcgttcagtccgacatgaaacactggcccttcaccgtcatcaacgacaacacgcgt
cctaaagtccaagtggagtacaaaggtgaaaccaagaccttctaccctgaggagatctcc
tccatggtgctgctgaagatgaaggagatcgcggaggcgtacctcggcaagacggtaaca
aatgctgtggtgacggttcctgcctacttcaacgactctcagcgccaagccaccaaagac
gccgggaccatttctggcctaaatgttctgcgtattatcaatgagcccactgccgctgcc
attgcttatggcctggacaaaaaggttgggtctgagaggcacgttctcatttttgacctg
ggcggcggcacgttcgacgtgtccatcttgaccattgaggacggcatcttcgaagtgaag
tccacggcgggtgacacgcacttgggcggcgaggacttcgacaaccgcatggtgaaccac
ttcatctcggagttcaagcgcaagtacaagaaggacatcagtgacaacaagagggcggtg
cgccgtctgcgcacggcgtgcgagagagccaagcgcacgctgtcgtccagcactcaggcc
agcatcgagatcgactccctgtacgagggcgttgacttctacacgtccatcaccagggca
cggttcgaggagctgaacgccgacctgttcaggggaactctggagcccgtggagaaggct
ctgcgtgacgccaagatggacaaggctcaaatccacgacatcgtcctagtgggagggtcg
actcgcatccctaaaatccagaagctgctgcaggacttcttcaacggcaaggatctgaat
aagagcattaaccctgatgaggcagtggcctatggcgcagccgtccaggcggccatcttg
tgcggcgacaaatcggagaacgttcaggacctgctgctgctggacgtgacccccctgtct
ctgggcatcgagactgcaggtggcgtcatgaccgtgctcatcaagaggaacaccaccatc
cccacaaagcagacgcagaccttcaccacctactccgacaaccagcccggggtgctcatt
caggtgtttgagggggaaagagccatgaccaaagacaacaacctgctggggaaatttgac
ctgacaggaatccccccggctcctcggggagtccctcagatcgaggtgacttttgacatc
gacgccaacggcattatgaacgtgtctgcggtcgacaaaagcactgggaaagagaacaaa
atcaccatcaccaacgacaaaggtcgcctgagcaaggaggacattgagcgcatggtccag
gaggcagagaagtacaaagccgaggacgacgtgcaacgagagaaggtgtcggccaagaac
ggcctagaatcctacgccttcaacatgaagtccaccgtggaggacgacaagctgaaggac
aagatcagcgaggaggacaagcagaagatcctggagaagtgcaacgaggtcatcagctgg
ctggacagaaatcagtacgcagagaaggaggagtttgagcaccagcagaaggagctggaa
aaggtgtgcaacccggtcatgacaaagctgtaccagagcgcgggaggggtgcccggcggg
atgcctggcggcatgcccggcggcttccccggagctggtggtgctcccggatcagcgggg
tcctccggccccaccatcgaggaagtggactga

DBGET integrated database retrieval system