KEGG   Kryptolebias marmoratus (mangrove rivulus): 108243280Help
Entry
108243280         CDS       T05608                                 

Gene name
sept7
Definition
(RefSeq) septin-7 isoform X1
  KO
K16944  septin 7
Organism
kmr  Kryptolebias marmoratus (mangrove rivulus)
Brite
KEGG Orthology (KO) [BR:kmr00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:kmr04131]
    108243280 (sept7)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:kmr04812]
    108243280 (sept7)
   04147 Exosome [BR:kmr04147]
    108243280 (sept7)
Membrane trafficking [BR:kmr04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Septins
    108243280 (sept7)
Cytoskeleton proteins [BR:kmr04812]
 Eukaryotic cytoskeleton proteins
  Septins
   Septins
    Group 2
     108243280 (sept7)
Exosome [BR:kmr04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   108243280 (sept7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Septin MMR_HSR1 RsgA_GTPase AIG1 AAA_22 AAA_16 FeoB_N Ras GTP_EFTU AAA_29 Gtr1_RagA AAA_7 ABC_tran Roc LMBR1
Motif
Other DBs
NCBI-GeneID: 108243280
NCBI-ProteinID: XP_017284089
Position
Unknown
AA seq 426 aa AA seqDB search
MAQQKNLDGYVGFASLPNQVYRKSVKRGFEFTLMVVGESGLGKSTLINSLFLTDLYSAEY
PGPSHRIKKTVQVEQSKVLIKEGGVQLLLTIVDTPGFGDAVDNSNCWQPIIDHIDSKFED
YLNSESRVNRRQMPDSRIHCCLYFIAPSGHGLKPLDIEFMKRLHEKVNVIPMIAKADTLT
PEECQQFKKQIMREIQEHKIKIYEFPETDDEEENRLVKKIKDKLPLAVVGSNTIIEVNGK
RVRGRQYPWGVAEVENSDHCDFTILRDMLIRTHMQDLKDVTNNVHYENYRSRKLAAVTYN
GVDNNKAKGQLSTKLDTVEGMSPLAQMEEERREHVAKMKKMEMEMEQVFEMKVKEKVQKL
KDSEAELQRRHEQMKKNLEAQHKELEEKRRVFEEERVNWETQQRLEQQKLEASRTLDKNK
KKGKIF
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atggctcaacaaaagaacctggatggatatgttggctttgcaagccttcccaaccaagtg
tacaggaagtccgtgaagaggggcttcgagttcaccctgatggtcgtgggtgagtcagga
ctgggcaagtcgactttgatcaattctctgttcctgacagacctgtattcagccgagtat
cccggaccgtcgcacagaatcaagaagaccgtacaggtggagcagtcgaaagtgttaata
aaggagggtggcgtccagctgctgctcacaatagtcgacaccccggggtttggagatgct
gtcgacaacagcaactgctggcagccgatcatcgaccacatagacagcaagttcgaggac
tacctgaactcagaatcccgggtgaaccggcgacagatgcccgacagccgaatccactgc
tgcctttacttcatcgccccctccggacacggactgaagcccttggacatcgagttcatg
aaacggttgcatgagaaagtcaatgtcatcccgatgatcgccaaagcagacactctcacc
ccggaggaatgccaacagttcaagaagcagatcatgagagaaatccaggagcacaaaatc
aagatttacgagtttcccgagacggatgacgaagaagaaaacaggctggtgaagaagatt
aaagacaagctgccgctggctgtggtcggaagcaacaccatcatcgaggtgaacggcaag
agagtgagaggaagacagtacccctggggcgtcgcagaagtggaaaacagcgaccattgt
gacttcaccatcctcagggacatgctcatcagaactcacatgcaggacctgaaggacgtg
acgaacaacgtccactatgaaaactaccggagcaggaagctggccgctgtcacctacaac
ggagtggacaacaacaaagcgaagggacaactgtccaccaaacttgacacagttgaagga
atgagccctctggcccagatggaggaggagcggcgagagcacgtggctaaaatgaagaag
atggagatggaaatggagcaggtgtttgagatgaaagtcaaggaaaaagtgcagaagctc
aaagactccgaagcagagctccagcggcgtcacgagcagatgaagaagaacctggaggct
cagcacaaggagctggaggagaagaggcgtgtcttcgaggaggagagggtaaactgggag
acccaacagcggctggagcagcagaaactggaggcctccaggactctggacaaaaacaaa
aagaaaggcaagatcttctag

DBGET integrated database retrieval system