KEGG   Kryptolebias marmoratus (mangrove rivulus): 108243328Help
Entry
108243328         CDS       T05608                                 

Gene name
nat1
Definition
(RefSeq) arylamine N-acetyltransferase 1 isoform X1
  KO
K00622  arylamine N-acetyltransferase [EC:2.3.1.5]
Organism
kmr  Kryptolebias marmoratus (mangrove rivulus)
Pathway
kmr00232  Caffeine metabolism
kmr00983  Drug metabolism - other enzymes
kmr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kmr00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00232 Caffeine metabolism
    108243328 (nat1)
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    108243328 (nat1)
Enzymes [BR:kmr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.5  arylamine N-acetyltransferase
     108243328 (nat1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Acetyltransf_2
Motif
Other DBs
NCBI-GeneID: 108243328
NCBI-ProteinID: XP_017284167
UniProt: A0A3Q2ZD05
Position
Unknown
AA seq 295 aa AA seqDB search
MSQSKGKMNLEEYFQRIGFRGSSYKADLATLTLIHKLHVMSVPFENLSIHCGERNVMDLE
VVFNKIVRSGRGGWCLENNSLFGWALREIGFDTTTLGSGVFTTDDFSPVNSHLIHKVVVD
GKAYIADVSFGVSYQIWEPLELISGKDQPQAAGVFRLIEKGGIWILEKTSRKPEVLNPEF
ANSSLVNRKEMKRIYHFTLEPREAEHFFEQCHTLQTDPACLFTNKSICSLQMPAGFKALI
GWTYIEVTYKPEEGMDVVDMRNIADDEVEQVLREQFKVKLLNKLKPVNKTVLYTL
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgtcacagtctaaaggaaagatgaatttggaggaatacttccaaaggattggtttccgc
ggctcctcgtataaggcggatcttgcgacgctgacgttgatccacaaactgcacgtcatg
tcggttccttttgaaaatctcagcattcactgtggtgagaggaacgtcatggacctggag
gttgtgttcaacaagattgtgaggagcggccgtggaggctggtgcctcgagaacaactcc
ctgtttggatgggcgctgagagaaataggcttcgacaccaccactttgggctccggggtc
ttcaccactgacgacttcagtcccgttaattctcatctcattcacaaggtcgtcgtggac
gggaaggcctacatcgccgatgtaagcttcggggtgtcatatcagatttgggagcccctg
gagctcatctcaggaaaagaccagccgcaggcagcgggggtgtttcgtctcatcgagaag
gggggcatatggatcctggagaagaccagcaggaaaccagaggtcctcaatccggaattt
gccaactccagcctggtgaacaggaaggagatgaagcggatctaccacttcaccctggag
cctcgagaggcagagcatttctttgagcagtgtcacacacttcagacagatccagcctgt
ctgttcaccaataagtccatctgctcgttgcagatgcccgcgggattcaaagctctgatt
ggctggacctacattgaggtcacctacaaacccgaggaagggatggatgttgtggacatg
aggaacattgcagatgatgaggtcgaacaggttctgagggaacagtttaaggtgaagctt
ctgaacaagctgaagcctgtcaataaaacagttttgtacaccttatag

DBGET integrated database retrieval system